KEGG   Thermobifida fusca: Tfu_0953Help
Entry
Tfu_0953          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhageMin_Tail Class_IIIsignal
Motif
Other DBs
NCBI-ProteinID: AAZ54991
UniProt: Q47RC6
Position
complement(1120621..1121265)
Genome map
AA seq 214 aa AA seqDB search
MTIYADRPLRRALQLGGDLLALAWIALGVWTAVALHRALAALARPGVLLHDAGDGLASHM
ASAAEAARNVPFVGDDLAAPLARLEATGDDLSAAGTGLQQTAAEFALLTAVAVAVLAVAV
ALGAWLPVRLRWIRQASQARQLTRLPGEAGTRLLALRALTAAPVPALCRLHDDPAEAWRS
GDERVVAELAALELRRLGLRPARPAPSDRDNQQQ
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctacgctgaccgtcccctgcgccgtgccctgcaactcggcggcgacctgctc
gcgctcgcctggatcgcgctcggagtgtggactgcggtcgcgctgcaccgggccctggcg
gcgctcgcccgccccggcgtcctcctccacgacgcgggcgacggcctcgccagccacatg
gccagcgcagccgaagcagcgcggaacgtgccgttcgtcggcgacgacctggccgcgccc
ctggcccggctggaagcgaccggggacgacctcagcgccgccggaacaggactccagcag
accgcggcggaattcgccctgctcaccgcggtggctgtcgcggtgctggcggtcgcggtc
gcgctcggcgcctggctgcccgtccggctccgctggatccggcaggccagccaggcccgg
cagctcacccggcttcccggcgaggccgggacccgcctgctcgcgctgcgcgccctgacc
gccgcgcccgtgcccgcgctgtgccgcctccacgacgacccggcggaggcgtggcgctcc
ggagacgagcgggtcgtggcggaactcgccgccctcgagctgcgccgcctcggcctgcgc
ccggcccgcccggctcccagcgaccgcgacaaccagcagcaatga

DBGET integrated database retrieval system