KEGG   Thermobifida fusca: Tfu_0955Help
Entry
Tfu_0955          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4126 DUF2232 Stevor PAP_PilO HemY_N DUF3377 DUF4574 TMEM154 DUF4079 Herpes_gE Protocadherin
Motif
Other DBs
NCBI-ProteinID: AAZ54993
UniProt: Q47RC4
Position
1121823..1122485
Genome map
AA seq 220 aa AA seqDB search
MEILTGIGLSSSAGLNAYVPLLVAGLLSRYTDLLSLGPSWQWLESPWTLGILAVLLIVEL
CADKIPALDHINDIIQTVVRPTSGGIVFGASGSAVLGEPEVAGDAAAASVGGDVSVWLAV
VGAAIALFFHLMKAAIRLLVNMLSVGVGAPVLSTMEDAASVAMAILAVLLPVLVVIAVVA
TAGLGIWLLVRLRRRRKQKKAEKAAQQDHQQWPEAQQPHA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatactgaccggaattggcctgtcatcgtcggccggcctgaacgcttacgttcct
ctcctggtggcggggctgctttcccgctacaccgatctactgtcgcttggtccttcctgg
cagtggctggaaagcccgtggacactgggaattctggctgtcctgctgattgttgaactg
tgcgcggacaagatccccgcgttggaccacatcaacgacatcatccagaccgtggtgcgc
cccacttccggcggcattgtcttcggtgcgagcggaagcgcggtactgggggagcccgag
gtcgcgggtgatgcggctgcggccagtgtcgggggagacgtcagcgtgtggctggcggtt
gtcggtgcggcgatcgccctcttcttccatttgatgaaggccgcgatccgcctgctggtc
aacatgctcagcgtcggagtcggcgcgccggtgctcagcacgatggaggacgccgccagt
gtggcgatggcgatcctcgccgtgctgctgccggtcctggtcgtcatcgcggtcgtggcc
acggccgggctcgggatctggctgctggtgcggttgcgccgtcggcgcaagcagaagaag
gcggagaaggcggcgcagcaggaccaccagcaatggccggaggcgcagcagccgcacgcc
tag

DBGET integrated database retrieval system