KEGG   Thermobifida fusca: Tfu_0961Help
Entry
Tfu_0961          CDS       T00265                                 

Definition
(GenBank) L-alanine dehydrogenase
  KO
K00259  alanine dehydrogenase [EC:1.4.1.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00250  Alanine, aspartate and glutamate metabolism
tfu00430  Taurine and hypotaurine metabolism
tfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tfu_0961
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Tfu_0961
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     Tfu_0961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlaDh_PNT_C AlaDh_PNT_N 3HCDH_N 2-Hacid_dh_C Pyr_redox_2 GIDA Pyr_redox NAD_binding_2 HI0933_like NAD_binding_8 Shikimate_DH UDPG_MGDP_dh_N FAD_oxidored Ank
Motif
Other DBs
NCBI-ProteinID: AAZ54999
UniProt: Q47RB8
Position
complement(1126833..1127954)
Genome map
AA seq 373 aa AA seqDB search
MRVGVPREIKDHEYRVAITPAGVQELVRHGHDVLIERDAGVGSAISNAEYAAAGARIIDS
ADEVWGAADLVLKVKEPVPEEYHRLRPGQVLFAYLHLAASRDCTEALLKHGVTAIAYETV
QLPDGSLPLLAPMSEIAGRLAPQVGATALQRSNGGRGVLLGGVPGVGPAKVMVLGAGVSG
MNAAQVAAGMGAEVTLLDIDIAKLRRADAVFQGRVRTLASTAYEIERTALESDLIIGAVL
IPGAKAPTLISSDLVAQMKPGTVLVDIAVDQGGCFADSRPTTHSDPTYPVHNTVFYCVSN
MPGAVPTTATQALTKDTLRYALALANKGWRDALADDPALAAGLNTFAGELTNEAVAQAHG
MAARTVTEVVAAG
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtcggcgtgccccgtgaaatcaaagaccatgaataccgagtagctatcaccccg
gccggcgtccaggagctcgtccggcacggccacgacgtcctcatcgaacgcgacgccggt
gtcggctcggccatcagcaacgccgaatacgcggccgcgggcgcccgcatcatcgacagc
gccgacgaagtgtggggagcggccgacctcgtcctcaaagtcaaagaacccgtccccgag
gaataccaccggctccgccccggccaagtgctcttcgcctacctgcacctggcggcgtcc
cgggactgcaccgaagccctcctcaagcacggagtcaccgcgattgcctacgaaaccgtg
cagcttcccgacgggtccctgcccctgttggcgcccatgtcggagatcgcgggacggctc
gccccccaagtcggcgcgaccgccttgcagcgctccaacggcggccgcggcgtcctgctc
ggcggagtgcccggtgtggggcccgccaaagtcatggtgctcggcgcgggtgtctccggc
atgaacgccgcccaagtcgcggcgggcatgggcgcggaagtcaccctgctcgacatcgac
atcgccaaactgcgccgggcggacgccgtgttccaaggccgggtgcggacgctggcgtcc
accgcctacgagattgaacggaccgccctggaatccgacctcatcatcggagcagtgctc
atccccggcgcgaaagcccccaccctgatcagcagcgacctggtcgcccagatgaaaccc
ggcaccgtgctcgtcgacatcgccgtcgaccaaggcggctgcttcgccgactcgcggccc
accacccactccgaccccacgtacccggtgcacaacacggtgttctactgcgtgtcgaac
atgcccggcgcggtgcccaccacggccacgcaggcgctgaccaaagacacgctgcgctac
gcgctggccctggcgaacaaaggctggcgggacgcgctcgccgacgacccggcgctcgcc
gcaggcctcaacacgttcgcgggagaactcaccaacgaggccgtggcccaagcccacggg
atggcggcgcgcaccgtcaccgaagtcgtggccgcgggatag

DBGET integrated database retrieval system