KEGG   Thermobifida fusca: Tfu_0964Help
Entry
Tfu_0964          CDS       T00265                                 

Definition
(GenBank) hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ55002
UniProt: Q47RB5
Position
complement(1132169..1132579)
Genome map
AA seq 136 aa AA seqDB search
MTSLLTTIAIFGLGGAVLNVALQGLLLTLIGRSTKTGPRLVSGIAIALLLLALPTLAAGR
LLSTVPQAGFASAFTVALCTALLILGSTLVFSTIAARRATQAKALPQLSGPTLYVGGLAT
CVLVGVLGAVTALLLV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctgctcaccaccatcgcgatcttcggcctcggcggggccgtactcaacgtt
gcgctgcaaggactgctgctcaccctcatcggccgttccaccaaaaccgggccgcgtctc
gtctccgggatcgccatcgccctgctgcttctcgccttgcccaccctggccgcgggccgt
ctgctgagcactgtgccccaggccgggttcgcgtccgcgttcaccgtggcgctgtgcacg
gccctgctcatcctcggttccacgctcgtcttctccacgattgcggcgcggcgcgccacc
caagccaaagcgctcccgcaactgtccgggcccaccctctacgtgggcgggctcgccacc
tgtgtcctcgtcggcgtcctcggcgccgtcaccgcactcctcctcgtctaa

DBGET integrated database retrieval system