KEGG   Thermobifida fusca: Tfu_0966Help
Entry
Tfu_0966          CDS       T00265                                 

Definition
(GenBank) caffeoyl-CoA O-methyltransferase
  KO
K00588  caffeoyl-CoA O-methyltransferase [EC:2.1.1.104]
Organism
tfu  Thermobifida fusca
Pathway
tfu00360  Phenylalanine metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Tfu_0966
Enzymes [BR:tfu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.104  caffeoyl-CoA O-methyltransferase
     Tfu_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_25 Methyltransf_18 PCMT Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AAZ55004
UniProt: Q47RB3
Position
complement(1133489..1134148)
Genome map
AA seq 219 aa AA seqDB search
MTRTSENLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQL
IGARNIVEVGTFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRL
APALDTLRALPEEPQFDLAFIDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPA
QTAARVQAIRDFNVHARDDTRVDLVILPIGDGFTLARRR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgacacgcacctcagaaaacctcagtccggaactgcacgcctacctggtcgcgcacagc
acccccgtcgacgaagtgctgaccgacctggccgcggaaaccgaacggctcttccccgac
cacgtcggcatgcagatcgcccccgaacaaggactgttcctcaccctgctcacccagctc
atcggggcacgcaacatcgtcgaagtcggcaccttcaccgggtattcgtcgatctgcctg
gcccgcggcctccccaacgacggcaccctgctcgcctgcgacgtcagcgaagaatggacc
gcggtggcgcgccgctactggcagcgggccggggtcgccgaccggatcgacctgcggctc
gcccccgccctcgacacgctgcgcgccctccccgaagaaccccagttcgacctggcgttc
atcgacgccgacaaagagtcctacatcgcctactgggaagaactcgtgccgcgggtgcgg
cccggcggggtgctgctcgccgacaacgtgttctcgcacagccgggtcctcgaccccgcg
cagaccgcggcccgcgtgcaagccatccgcgacttcaacgtgcacgcccgcgacgacacg
cgggtcgacctggtcatcctccccatcggcgacggcttcaccctggcgcggcgcagatag

DBGET integrated database retrieval system