KEGG   Thermobifida fusca: Tfu_0967Help
Entry
Tfu_0967          CDS       T00265                                 

Definition
(GenBank) putative integral membrane protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YdjM
Motif
Other DBs
NCBI-ProteinID: AAZ55005
UniProt: Q47RB2
Position
complement(1134174..1134887)
Genome map
AA seq 237 aa AA seqDB search
MMGHSHALSGVVGWMAVVPLLNKVDVLGINFELGSGEIIAGGLVCAGAALIPDLDHKSAT
ITKTYGVFTETLGAFFNWAFGGHRNGTHSLLFALLLGGFAQLLVLWSELAAQIFVFLLIG
IAFNGLGYGMEKNRVAAEFINALATAGITLALYSSGVDYSWLGLAVAYGCLLHYLGDIAT
QMGVPLLWPFWKYRFGQNIGFKTDGPVERKVITPMLTISIVLMSIYLFPWKELIPDL
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatggggcactctcacgcgctgagcggcgtggttggatggatggctgtcgtccccctg
ctcaacaaggtggacgttctcggcatcaactttgaactcggatccggggaaatcatcgcg
ggcgggctcgtctgcgcgggcgccgcgctcatccccgacctcgaccacaagagcgcaacc
atcaccaaaacctacggggtgttcaccgaaaccctcggcgcgttcttcaactgggcgttc
ggcgggcaccgcaacggcacccattcactgctgttcgcgctactcctcggcggattcgcg
caactcctcgtcctctggtccgaactcgccgcccaaatattcgtcttcctgctcatcggg
atcgcgttcaacgggctcggctacggcatggagaaaaaccgggtcgccgccgaattcatc
aacgcgctcgccaccgcgggaatcacactcgccctctacagttcgggcgtcgactattca
tggctcggcctggccgtggcctacgggtgcctcctgcactacctgggagacattgccacc
cagatgggggtgccgctgctgtggccgttctggaaataccggttcgggcagaacatcggc
ttcaaaaccgacgggcccgtggaacgcaaagtcatcacccccatgctcaccatctccatc
gtgctcatgtccatctacctgttcccgtggaaagaactcatccccgacctgtga

DBGET integrated database retrieval system