KEGG   Thermobifida fusca: Tfu_0968Help
Entry
Tfu_0968          CDS       T00265                                 

Definition
(GenBank) methionine aminopeptidase, type I
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
tfu  Thermobifida fusca
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tfu01002]
    Tfu_0968
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     Tfu_0968
Peptidases [BR:tfu01002]
 Metallo Peptidases
  Family M24
   Tfu_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-ProteinID: AAZ55006
UniProt: Q47RB1
Position
complement(1135566..1136417)
Genome map
AA seq 283 aa AA seqDB search
MTTPLVPGRISPPRTVPPSIPRPEYVGKKHPVKGVAGDVQTPETIEAMRVAGRIAAQALQ
EVGKHVKPGVTTDELDRIGHEFLCDHGAYPSPLGYKGFPKSLCTSINEVICHGIPDDTVL
QDGDIINIDVTAYIHGVHGDTNATFLVGDVDEESRLLVERTREALMRGIQACKPGRQINV
IGRVIESYAKRFGYGVVRDFTGHGVGPEFHSGLIIPHYDDPSADTVMVPGMTFTIEPMIT
LGTIDYEVWDDGWTAVTKDRKRTAQFEHTLVITDDGAEILTLP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactaccccgctggtacccgggcgtatctcgcccccacgaacggtcccgccgtccatc
ccccggcccgaatacgtcggtaagaaacatcccgtcaaaggggtcgctggggatgtgcag
accccggagaccatcgaagccatgcgggtggccggccggatcgctgcgcaagcactccaa
gaagtcggcaaacacgtgaagcccggcgtcaccacagacgaactcgaccggatcggccac
gagttcctgtgcgaccacggcgcctaccccagcccgctcggctacaagggcttccccaag
tcgctgtgcacgtccatcaacgaagtcatctgccacggcatccccgacgacaccgtcctc
caggacggtgacatcatcaacatcgacgtcaccgcctacatccacggggtgcacggcgac
accaacgccaccttcctcgtcggcgacgtcgacgaagaatcccggctgctcgtggaacgc
acccgcgaagccctcatgcgcggcatccaagcgtgcaagccaggccggcagatcaacgtc
atcggccgggtcatcgagtcctacgccaaacgcttcggctacggcgtggtgcgcgacttc
accgggcacggtgtggggcccgaattccactccgggctgatcatcccccactacgacgac
ccgagcgccgacacggtcatggttcccgggatgaccttcaccatcgaacccatgatcacc
ctgggcaccatcgactacgaagtctgggacgacgggtggaccgcggtcaccaaagaccgc
aaacgcaccgcccagttcgaacacaccctcgtcatcaccgacgacggcgcagaaatcctc
accctcccctga

DBGET integrated database retrieval system