KEGG   Thermobifida fusca: Tfu_0970Help
Entry
Tfu_0970          CDS       T00265                                 

Definition
(GenBank) reduced coenzyme F420:NADP oxidoreductase
  KO
K06988  8-hydroxy-5-deazaflavin:NADPH oxidoreductase [EC:1.5.1.40]
Organism
tfu  Thermobifida fusca
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tfu_0970
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.40  8-hydroxy-5-deazaflavin:NADPH oxidoreductase
     Tfu_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_oxidored IlvN NAD_binding_2 Shikimate_DH adh_short Semialdhyde_dh NAD_Gly3P_dh_N NmrA PDH 3HCDH_N ApbA 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AAZ55008
UniProt: Q47RA9
Structure
PDB: 

Position
1136729..1137427
Genome map
AA seq 232 aa AA seqDB search
MIMIMASKSSPHDLPDVSGLSIAVLGGTGDQGRGLARRFAMAGHEVILGSRSAERAQAVA
AELGEGLPVRGMDNAGAAEAGDVVIVAVPWDGHRALLESLKDVLAGKIVVDCVNPLGFDK
RGAYALPVEEGSAAEQAAAILPDSRVVAAFHHVSAVLLLDPEVEKVDLDVLVLGDDREAT
DVVRALAARIPGVRGVYGGRLRNAHQVEAFTANLISINRRYKAHAGIRITDI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgattatggcatcgaagagttctccgcacgatcttcctgacgtctctggcctg
tcgattgccgtgctggggggcacgggtgatcagggccgcggcttggcgcgccggttcgcg
atggccgggcacgaggtgattctcggttcgcggagcgcggagcgggcccaggcggttgcc
gccgagttgggcgagggcttgccggtccgcggcatggacaacgcgggcgcggccgaggcc
ggggacgtggtgatcgtggcggttccgtgggacggtcaccgtgccctgctggagtcgttg
aaggatgtgctggcgggcaagatcgtcgtcgactgtgtgaacccgctgggtttcgacaag
cgcggcgcgtatgcgctgccggttgaggaggggagcgctgccgagcaggctgccgcgatc
ctgccggacagccgcgtggtggccgcgttccaccacgtgtccgccgtgcttttgctggac
cccgaggtcgagaaggtggatttggacgtgctcgtgctcggggacgaccgtgaagccacc
gatgttgtgcgcgctttggcggcccgtatccccggggtgcggggagtttacggcgggcgc
ctgcgcaacgcccaccaggtggaggcgttcaccgccaacctgatttcgatcaaccgccgt
tacaaggcccacgcgggtatccgcatcaccgacatctaa

DBGET integrated database retrieval system