KEGG   Thermobifida fusca: Tfu_0971Help
Entry
Tfu_0971          CDS       T00265                                 

Definition
(GenBank) putative DNA methylase
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Eco57I N6_Mtase UPF0020 TaqI_C Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AAZ55009
UniProt: Q47RA8
Position
complement(1137502..1141170)
Genome map
AA seq 1222 aa AA seqDB search
MVDHALLLADLKKQVRVLEEDLRERSEDPEAINEHTGIPFAHELKREYQRAFDAGRTAAT
YGAWRDERVTQAAVAWVLATVFVRFCEDNRLLEQPFISGPRDASGRYDIAQELRDAWVAE
DRSRTDRDWLIHAFEAMSVSPIVRGLFDRAHNPMWTITPSHQAAKNLIAFWREVGDDGHI
RHDFTDPDWNTRFLGDLYQDLSEDIRENYALFQTPEFVEEFILDYTLEPAIDEFGLDGQG
GRVYQANSQGFRLIDPTCGSGHFLIGAFHRILARWREAAPGASDWDLIARTLRSIHGVDK
NPYAVAIARFRLLIAAMKEAGITTLSQGNPDWPIVVATGDSLIHGRGAPQRKETLFDDEQ
VHHYATEDVYNYQAEYDLLGVNSYHAVVGNPPYITVKDKKENQNYRERYQACYREYALSV
PFAERFFNLAKRAGGDGAGAGFVGQITANSFMKREFGKKLINEFFRNQVRLTHIIDTSGA
YIPGHGTPTVILFGRNMPNTHTTTIRAVLGIQGEPSQPDSPADGLVWSAITNQIEQPGSE
SEWISVSNLPWDHFKKHPWSLSGGGANKLMQFFQKWSKEKLQSKIEEIGFGAVTREDSAY
MVGRGTLLRHGISKENQRPLIEGDTIRDWNIRNSLVSLWPYQSETLEAFSDDAINKFLYP
YRNILRNRVAYGNTQLERGLSWFEYSMFFSERYRIPLSIAFAFVATHNHFVLDRGGKVFN
RTAPVIKLPEGATEDQHLELLGVLNSSTACFWLKQVSYDKGSQGLKEWERYEFTGTKLQE
FPLPDSLPLERARELDALAQQLSLLEPSAVVEAGTPSRAGLNEARAEYFRIRSRMIALQE
ELDWDVYHRYGLISDAERAELVIPDTAAVPGIAFGERAFEIVLARKLAAGEVKTEWFARH
GATPITEIPAHWPEAYKRVVARRIEFIESRKDLALLERPEYKRRWHAEPWEKKEKAALKA
WLLDKCETRQIWFAPTESGEEAPRVRTVVELANRLRDVCPEAVAVADLYDPDADFTDVIA
QIVEAEHVPYLAAWRYKESGLRKRQQWEEVWHLQRQEDALNAERAEGEPERRLDIPVPPR
YTSADFRKPSYWANRGKLDVPKERFISYPGAETDQDGSLVLGWAGWDHAQQVQALTDLAF
NRLDEHGWVDDRDKMTPLLAGLVELRPWVRQWHTTPDEYGQSPADYLDEDLAELKDRTGI
TDSDMQAWRPKTTRRGGRKKAS
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
gtggttgaccacgctctactgcttgccgacttgaagaagcaggtccgcgtccttgaagag
gacctgcgtgagcgcagcgaagatccggaagcgatcaacgaacacaccggcatcccgttt
gcccatgagttgaagcgggagtatcagcgggcgtttgatgctgggcgcacagctgctacc
tatggggcctggcgcgatgagcgggtgacgcaggctgcggtggcgtgggtgttggccacc
gtgttcgtccgcttctgcgaagacaaccggctgttggagcagccctttatctctgggccc
agggatgcgagtgggcgttatgacattgctcaggagttgcgggatgcgtgggtggctgag
gaccggtcgcgcacggaccgtgactggctgatccacgcgtttgaggcgatgagtgtgtcg
ccgattgtgcgggggttgtttgatcgggcccacaaccccatgtggactatcaccccttcg
catcaggcggctaagaacctcatcgctttttggcgcgaggtcggggatgacggccacatc
cgccatgacttcaccgaccccgactggaacacccgcttcctcggcgacctctaccaagat
ttgtctgaagacatccgcgaaaactacgcgctctttcagactccggagtttgttgaggag
ttcatcctcgactacacccttgagcccgctatcgacgaattcggcctggatgggcaaggc
ggccgtgtctaccaggctaacagccaaggcttccgtttgatcgaccccacgtgtgggtcg
gggcacttcctcatcggcgccttccaccgcatccttgctcgttggcgggaagccgccccc
ggggcctctgactgggatttgatcgcccgcaccctaagaagcatccacggtgtggacaaa
aacccctacgccgtcgccatcgcccgctttcgcctgctgatcgcggcgatgaaagaagca
ggcatcaccacactctcccaaggcaaccctgattggcccatcgtcgtggccaccggagac
tccctcatccacgggcgaggagccccacagcgcaaggagactctgttcgatgatgagcag
gtccaccactatgccactgaggatgtctataactaccaagccgaatatgacctgctcggg
gtcaacagctaccacgcagtggtaggcaacccgccctacatcaccgttaaagacaagaaa
gaaaaccagaattatcgagaacgataccaagcctgctatcgggaatacgcactttctgtt
ccgtttgctgaacggttctttaacctcgccaagcgagccggtggtgacggagcaggcgca
ggattcgttggacagattaccgcaaactcgttcatgaaacgcgagttcggcaaaaaactc
atcaacgaattcttccgtaaccaggtacgcctcacccacatcatcgacacttctggagct
tatatccctgggcatgggactccgacggtcatcctgtttggtcgtaacatgcccaacacc
cataccacgactatccgtgcggttcttggcattcagggggaaccttctcagccggatagc
cctgccgacggtttggtctggtctgccataaccaaccagatcgaacaaccaggaagcgaa
agcgaatggattagtgtctctaatcttccctgggatcacttcaagaaacatccgtggagt
ttaagcggcggcggcgctaataaattgatgcaatttttccaaaaatggagcaaagagaag
cttcaatcaaaaattgaagaaattggttttggtgcagtaacccgagaagacagcgcttat
atggtaggtcgaggcactctcctgcgccacggaatatctaaagagaatcagcgcccactc
atcgaaggcgataccataagagactggaatatcagaaattcactggtttctctttggcct
tatcaaagcgagactctagaagctttttctgacgacgcgattaataaattcctctatcca
tacaggaacattctaagaaaccgagttgcatatggaaatactcagctagagcgtggactt
agctggtttgaatactctatgttcttttcggagagatacaggattccgctttctatagct
ttcgcttttgtggccacgcacaaccacttcgtgttggatcggggtgggaaggtcttcaac
cgtactgctccggtgatcaagcttcccgagggggctacggaggatcagcatctggagctt
ttgggggtgttgaattcttctacggcctgtttctggctcaagcaggtcagttatgacaaa
ggaagccaggggcttaaagagtgggaaaggtacgagttcactggtacgaagcttcaggag
tttccgcttcctgactctttgccgttggagcgtgctcgggagttggatgctctcgctcag
cagctttccttgctggagccgtcagcggtggtggaggctggcacgccgtcccgtgctggg
ttgaatgaggcgcgtgcggagtatttcaggattcgatcccgcatgattgcgctgcaagaa
gagttggactgggatgtctatcaccgttatggcctcatcagcgatgctgagcgtgctgag
ttggtgatacctgatacggctgcggtgccggggattgcgtttggggagcgggcgtttgag
atcgtgctggcccgcaaactcgccgcaggcgaggtgaagaccgaatggttcgctcggcat
ggtgccaccccgattacggagattcctgcgcattggcctgaggcgtacaagcgggtggtg
gctcgtcggatcgagttcatcgaatcccgcaaagacctcgctcttctggagcgtcccgag
tacaagcggcgctggcatgccgagccttgggagaagaaggaaaaggcggcgctgaaagcc
tggctgctggacaagtgcgagacccggcagatctggtttgcccccactgagagtggtgag
gaagccccgcgagtgcgtacggtggtggagttggctaaccggttgcgggatgtctgtcct
gaagcggtggctgtggctgatctttatgatccggatgctgacttcaccgatgtgatcgcc
cagatcgtagaagcagagcatgtgccctacctggcggcatggcgttacaaagaatccggc
ctgcgtaaacgccagcagtgggaagaagtctggcacctccagcgccaagaagatgctctc
aacgccgagcgggctgaaggcgagcctgagcggcggctcgacattccggtgccaccgcgt
tacacctccgcggacttccgcaagccctcctactgggctaatcgcggaaagctggatgtg
cccaaggaacgcttcatctcctatccgggtgcggaaaccgaccaggacggctccctggtg
ctcggctgggccggatgggatcacgcccagcaagtccaagccctcactgatctagcgttc
aaccggcttgacgaacacggctgggtcgacgaccgcgacaaaatgaccccgctgctagcc
gggttggtcgaactgcggccgtgggtgcgccagtggcacaccaccccggatgagtacggg
caaagccctgccgactacctggatgaagacctcgccgagctcaaagaccgcaccggcatc
accgacagcgacatgcaagcatggcggcctaaaaccacccgccgaggtggtcgcaaaaag
gcaagctaa

DBGET integrated database retrieval system