KEGG   Thermobifida fusca: Tfu_0977Help
Entry
Tfu_0977          CDS       T00265                                 

Definition
(GenBank) helix-turn-helix motif
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_31 HTH_3 HTH_19 HTH_37 HTH_25 HTH_26 HTH_23 Docking
Motif
Other DBs
NCBI-ProteinID: AAZ55015
UniProt: Q47RA2
Position
complement(1145223..1146071)
Genome map
AA seq 282 aa AA seqDB search
MSRGSPVRKHYLVSQLKRLRAEARLSQEQVAEEMGWDVSKLYRIENGRFVRLNPESVAAL
CRLYGADDGLFEELVAIAKAARRHKPWWSQFEEGAGNDFYSVEYEATLIEEYAVGLVPEL
VQHPDYWAALVRRRVPAGSAEYQKLCAALRQRQAAVLERDDPPRFWSVVDESALRCAVGG
PQVMRAQLTHLLELVKHPNLVIQVLPLSQGMAHPATFTVLRLDGGAKVGYIGVPPHGCFV
DGGDRVAAYAQRFELLQATALPPQETPGYLRRVLAELEDADG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccggggctctccagtgcgcaagcactacctggtcagccaactcaaacggttgcgc
gcggaggcgcggttgtctcaagagcaggtcgccgaagaaatgggttgggatgtcagcaag
ctttatcggattgagaatggccgcttcgtccggcttaatcctgaatcggttgccgcgcta
tgccgcctgtatggggcggatgacgggttatttgaggaattggtcgctattgctaaggct
gcccgcaggcataaaccgtggtggtctcagtttgaggagggtgcgggaaacgatttttac
agcgtggaatacgaggcgaccttgatcgaggagtatgctgtcggcctggttccggaactg
gtgcagcatccggactactgggccgcgctggtgcggcgcagagtgcccgcggggtccgcg
gagtaccagaagctgtgtgctgcgctgcgccaacggcaggccgcggtgttggagcgcgac
gatccgccgcggttctggtcggtggtcgacgagtcggcgctgcgctgcgcggtgggcggc
ccgcaggtcatgcgcgcccagctcacgcaccttctcgagctggtgaagcatcctaatctc
gtcattcaagtactccctttgtcgcagggcatggctcatcccgccaccttcacggtgttg
cgcctcgacggtggtgcgaaggtggggtacatcggcgtccccccgcacggttgtttcgtg
gacggaggcgacagggtcgcggcctatgcgcagcggttcgagttgttgcaggccacggcg
ttgcctccgcaggagactcccggttacctccgccgtgttctggccgagctggaagacgcc
gatgggtga

DBGET integrated database retrieval system