KEGG   Thermobifida fusca: Tfu_0982Help
Entry
Tfu_0982          CDS       T00265                                 

Definition
(GenBank) L-glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
tfu  Thermobifida fusca
Pathway
tfu00220  Arginine biosynthesis
tfu00250  Alanine, aspartate and glutamate metabolism
tfu00630  Glyoxylate and dicarboxylate metabolism
tfu00910  Nitrogen metabolism
tfu01100  Metabolic pathways
tfu01120  Microbial metabolism in diverse environments
tfu01230  Biosynthesis of amino acids
tfu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tfu_0982
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Tfu_0982
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tfu_0982
   00220 Arginine biosynthesis
    Tfu_0982
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tfu_0982
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tfu04147]
    Tfu_0982
Enzymes [BR:tfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     Tfu_0982
Exosome [BR:tfu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tfu_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N Gln-synt_N_2
Motif
Other DBs
NCBI-ProteinID: AAZ55020
UniProt: Q47R97
Position
complement(1149921..1151282)
Genome map
AA seq 453 aa AA seqDB search
MNRQQEFVLRTLEERDIRFVRLWFTDVLGYLKSVAVAPAELEAAFTEGIGFDGSAIEGFA
RVYESDMLAQPDPTTFQVLPWRNEPHGAARMFCNILLPDGSPSYADPRNVLKRQLSRASD
LGFTFYTHPEIEFYLLKKKPERGELPEPSDEGGYFDHTPHSLARDFRRNAIMMLEEMGIS
VEFSHHEGGPGQQEIDLRYADALTTADNIMTFRMVMKEVAIEQGVYATFMPKPFTEHPGS
GMHTHMSLFEGDRNAFYEAGAEYQLSKIGRGFIAGLLRHAAEITAVCNQFVNSYKRLWGN
AAASAGAGGEAPAYICWGHNNRSALVRVPMYKPRKSNSARIEFRALDSACNPYLAFTVIL
AAGLKGIEEGYELPPGASDDVWALTDAERRALGIMPLPQSLDEALRVMERSELVAEALGE
HVFDFFLRNKKAEWEDYRRQVTPYELERYLPTL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgacagcaggaattcgtgctccggactcttgaggagcgcgatatccgcttcgtg
cgactgtggttcaccgacgtgctcggttacctcaagtcggttgcggtggctcccgccgaa
ctggaggccgcttttacggaagggatcgggttcgacggttccgctatagaagggtttgcg
cgggtctatgagtcggacatgctggcccagccggacccgacgacgttccaggtgctgccg
tggcgcaacgagccgcacggtgcggcgcgcatgttctgcaatatcctgctgccggacggc
tcgcccagctacgccgacccccgcaacgtgctgaaacggcagttgagccgggcttctgat
ctggggttcacgttctacacgcacccggagatcgagttctacctgctgaagaagaagccg
gagcgcggggagctgccggagccgagcgacgagggcggctatttcgaccacacgccgcat
agtctggcgcgggatttccgccgcaacgcgatcatgatgctggaagagatgggcatttcg
gtggagttcagccaccacgagggcgggcccggccagcaggagatcgacctgcggtatgcg
gatgcgttgaccaccgccgacaacatcatgacgttccgcatggtgatgaaggaggtggct
atcgagcagggcgtgtatgccacgttcatgccgaagccgttcaccgagcatcccgggtcc
ggcatgcacacccacatgtctctgttcgagggggaccgcaacgccttctacgaggcgggc
gcggagtaccagttgtcgaagatcggccgcgggttcattgccgggctgctgcggcatgcc
gcggagatcacggcggtgtgcaaccagttcgtgaactcgtataagcggctgtggggcaat
gccgcggcgtccgcgggggcgggcggtgaggcgcccgcgtacatctgctgggggcacaac
aaccggtcggcgctggtgcgggtgccgatgtacaagccgcgcaagagcaattcggcgcgg
atcgagttccgggcgctggattcggcgtgcaacccttatctcgcgttcacggtgattctg
gccgcggggttgaaggggatcgaggagggctacgagcttcctccgggcgcgtcggacgac
gtgtgggcgctcacggatgcggagcgccgggcgctggggatcatgccgctgccgcagagc
ctggatgaggcgctgcgggtgatggagcgcagcgagctggtcgcagaggcgctgggcgag
cacgtgttcgatttcttcttgcgcaacaagaaggcggagtgggaggactaccgccgccag
gtgaccccgtacgagctcgaacgctatctgccgactttgtaa

DBGET integrated database retrieval system