KEGG   Thermobifida fusca: Tfu_0991Help
Entry
Tfu_0991          CDS       T00265                                 

Definition
(GenBank) lipoate synthase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
tfu  Thermobifida fusca
Pathway
tfu00785  Lipoic acid metabolism
tfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Tfu_0991
Enzymes [BR:tfu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Tfu_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-ProteinID: AAZ55029
UniProt: Q47R88
Position
complement(1162721..1163659)
Genome map
AA seq 312 aa AA seqDB search
MSIAPEGRRLLRIEARNSTTPIEKKPPWIKIRAKMGSEYTELHALVKREGLHTVCQEAGC
PNIYECWEDREATFLIGGDQCTRRCDFCQIATGKPAALDRGEPLRVAESVRTMGLKYATV
TGVARDDLDDGGAWLYAETVRKIHELNPGTGVELLIPDFNADPDLLAEVFSSRPEVLAHN
IETVPRIFKRIRPGFRYERSLEVITRAREAGLVTKSNLILGMGETREEISQAMRDLYEAG
CDLLTITQYLRPSRLHHPVDRWVKPEEFVELGREAEEIGFAGVMSGPLVRSSYRAGRLYR
QAIERRKADAKS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcgctcccgagggccgccgcctgttgcggatcgaagcccgcaacagcactacc
ccgattgagaagaagccgccgtggatcaagatcagggcgaagatgggctcggagtacacc
gagctgcacgccctggtcaaacgcgagggcctgcacacggtgtgccaggaggccgggtgc
cccaacatctacgagtgctgggaggaccgggaggccacgttcctcatcggcggcgaccag
tgcacgcgacgctgcgacttctgccagatcgctaccgggaagccggcggcgttggaccgg
ggggagccgctgcgggtcgccgagtcggtgcgcacgatgggtctcaagtatgcgacggtc
accggggtggcccgcgacgacttggacgacgggggcgcgtggctgtacgcggaaacggtc
cgcaagatccacgagttgaaccccggcaccggcgtggagctgctgatccccgacttcaac
gccgacccggacctgctggccgaggtgttcagctcccggccggaggtgctggcgcacaac
attgagacggtgccgcggatcttcaagcgcatccgtcccgggttccgctacgagcgttct
ttggaggtgatcacccgggcccgcgaggcggggctggtcaccaagtcgaatctgatcctg
ggcatgggcgagacccgggaggagatcagccaggcgatgcgggacctgtacgaggccggg
tgcgacttgttgacgatcacccagtacctgcggccgtcccgcttgcaccacccggtggac
cggtgggtgaagccggaggagttcgtggagctgggccgggaggccgaggagatcggtttc
gccggggtgatgtcgggtccgctggtgcggtcgtcgtaccgggcgggccggttgtaccgc
caggcgatcgagcgtcgcaaggcggacgcgaaatcgtaa

DBGET integrated database retrieval system