KEGG   Thermobifida fusca: Tfu_0993Help
Entry
Tfu_0993          CDS       T00265                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tfu  Thermobifida fusca
Pathway
tfu00020  Citrate cycle (TCA cycle)
tfu00310  Lysine degradation
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
tfu01200  Carbon metabolism
Module
tfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tfu_0993
  09105 Amino acid metabolism
   00310 Lysine degradation
    Tfu_0993
Enzymes [BR:tfu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tfu_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H Trypan_PARP TonB_N
Motif
Other DBs
NCBI-ProteinID: AAZ55031
UniProt: Q47R86
Position
complement(1164750..1166492)
Genome map
AA seq 580 aa AA seqDB search
MSTPVTMPDLGESVTEGTVTQWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPVSGVLTKIL
VGEDETVEVGAQIAIITPAGEAPPAQPAPETAAEPAAQPEPEPEPAPQPAAEARTEPAAP
VADAGAATPVTMPNLGESVSEGTVTQWLKQEGDTVEADEPLLEVSTDKVDTEIPSPVSGV
LTKILVGEDETVEVGAQIALISPAGQAAAPAAPAAPQPAPEPKPEARPEPAPQPAAQPEA
AARTEPAPQPRRTRDDETPTVDLETISGTGQVLGTDATSEGYVTPLVRKLAAQEGVDLSQ
VKGTGVGGRIRKQDVLEAARRMREQRQRAAAAPAPAAADTALRGRTETMSRLRQTFAEQI
VESLHTAAQLTQVVEVDVTAIARLREQVGERFAAETGVELGFFPFFALAVVEALQRHPKL
NAVIDGTEVTYHDTENLAVVVDTEQGVLAPVVKDAGRLSLRELARRIDDLGARARTARLV
PDELSGGTFTMVDSGAYGALVETPIIHQPQVAVLSTGTVVKRPVVVEEPQLGEVITVRSM
VYLSLSFDHRLIDGADAARFLSDVKRRLEEGAFEDAVGLK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcccgttaccatgcccgatctgggcgaaagcgtcaccgagggcactgtcacc
caatggctcaagcaggagggcgacacggtcgaggtcgacgagccgctgctcgaagtctcg
acagacaaggttgacaccgaaatcccctcccccgtctccggtgtcttgacgaagatcctg
gtcggcgaagacgagactgttgaggtcggcgcgcagatcgcgatcatcactccggctggg
gaggcgccgccggctcagcccgctcccgagacggcggctgagccggcggcccagccggaa
ccggagccggagcctgctccgcagcctgccgcggaggcccgcaccgagcccgctgctccg
gtggctgacgccggtgccgctaccccggtgaccatgccgaacttgggggagagtgtcagc
gagggcacggtcacccagtggctgaagcaggagggcgacacggtcgaggccgacgagccg
ctgctcgaagtctcgacagacaaggttgacaccgaaatcccctcccccgtctccggtgtc
ttgacgaagatcctggtcggcgaagacgagactgttgaggtcggcgcgcagatcgcgctg
atcagtcctgccgggcaggctgctgcgcctgctgccccggcggctccgcagcccgcaccc
gagccgaagccggaggcacggcccgagcccgcaccgcagcctgctgcgcagccggaagct
gcagcccgcacggagcccgcaccgcagccgcgccgcacccgggacgatgagaccccgacc
gtggacttggagacgatcagcggcaccggccaggtgctgggcacggacgcgaccagtgaa
gggtatgtgaccccgctggtgcggaagcttgccgcccaggagggtgtggacctgtcccag
gtgaagggcaccggggtgggtggccggatccgcaagcaggacgtgttggaggcagcgcgg
cggatgcgggagcagcggcagcgtgctgctgcggcaccggcgcccgcggccgcggacacg
gcgctgcggggccgcacggagacgatgtcgcggctgcggcagacgttcgccgagcagatc
gtcgagtcgctgcacacggcggcgcagctcacccaggtggtggaggtggatgtcaccgcg
atcgcccggctgcgggagcaggtgggcgagcggttcgccgccgagaccggcgtggagttg
ggcttcttcccgttcttcgcgctggccgtggtggaggcgctgcagcggcacccgaagctc
aacgcggtgatcgacggcaccgaggtgacctaccacgacaccgagaacctggcggtggtg
gtcgacaccgagcagggtgtgctggccccggtggtcaaggacgcgggccgcttgtcgctg
cgggagctggcccggcggatcgacgacttgggggcgcgggcgcgcacggcgcggctggtg
ccggacgagttgagcggcggcacgttcaccatggtggacagcggcgcgtacggcgcgctg
gtggagacgccgatcatccaccagccgcaggtggcggtgttgagcacgggcaccgtggtg
aagcgtccggtggtggtcgaggagccgcagctgggcgaggtgatcacggtccggtccatg
gtgtacctgtcgttgagcttcgaccaccggctcatcgacggcgcggatgcggcccggttc
ctctccgatgtgaagcgccggttggaggagggcgcgttcgaggacgctgtggggctcaag
tag

DBGET integrated database retrieval system