KEGG   Thermobifida fusca: Tfu_0994Help
Entry
Tfu_0994          CDS       T00265                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
tfu  Thermobifida fusca
Pathway
tfu00010  Glycolysis / Gluconeogenesis
tfu00020  Citrate cycle (TCA cycle)
tfu00260  Glycine, serine and threonine metabolism
tfu00280  Valine, leucine and isoleucine degradation
tfu00620  Pyruvate metabolism
tfu00630  Glyoxylate and dicarboxylate metabolism
tfu00640  Propanoate metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
tfu01200  Carbon metabolism
Module
tfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tfu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_0994
   00020 Citrate cycle (TCA cycle)
    Tfu_0994
   00620 Pyruvate metabolism
    Tfu_0994
   00630 Glyoxylate and dicarboxylate metabolism
    Tfu_0994
   00640 Propanoate metabolism
    Tfu_0994
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tfu_0994
   00280 Valine, leucine and isoleucine degradation
    Tfu_0994
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tfu04147]
    Tfu_0994
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Tfu_0994
Exosome [BR:tfu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Tfu_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA Pyr_redox_3 FAD_oxidored HI0933_like AlaDh_PNT_C NAD_binding_8 FAD_binding_2 DAO 3HCDH_N 2-Hacid_dh_C Methyltransf_17 Thi4 Trp_halogenase Rota_NS35
Motif
Other DBs
NCBI-ProteinID: AAZ55032
UniProt: Q47R85
Position
complement(1166577..1167956)
Genome map
AA seq 459 aa AA seqDB search
MSESGGTFDLVILGGGSGGYSAAIRASELGMRVALIEKDKLGGTCLHYGCIPTKALLHAG
EVADTVRASEKFGVRASFDTIDMARVHEYKDKVVSGLHRGLTGLIKARGITLVEGEGKLT
GVDEVTVNGVAYKGRHIILATGSQARSLPGLEIDGERIITSYEALRLDRVPKSAIILGGG
VIGVEFASVWRSFGAEVTIVEALPHLVPAEEESSSKLLERAFRKRGIKFELGSPFESVKL
TETGVSMTLASGKTVEGELLLVAVGRGPVSQGLGYEEVGIRLERGFVQVDENLHTGVGNI
YAVGDLIPTPQLAHVGFAEGIFVAEHIAGLNPVNIDYDGIPRVTYSDPEVASVGITSKTA
AERGIETTEFVYNLAGNGKSQILQTQGAVKVIAAKDGPVLGVHMVGSRVGELITEGQLIY
NWEALPSEVAQLIHAHPTQSEALGEAHLALAGKPLHVHD
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaagcggcggcacattcgatctcgtcatcctgggcggcggtagcggtggctac
tcggccgccatccgcgcctccgaactcggcatgcgtgtcgccctgattgagaaagacaag
ctcggcggcacctgcctgcactacggctgtattccgaccaaggccctgctgcacgcgggt
gaggtcgccgacacggtgcgggccagcgagaagttcggtgtccgggcctcgttcgacaca
atcgacatggcccgtgtccacgagtacaaggacaaggtcgtcagtggtctgcaccgcggc
ctgaccggtctgatcaaggcccgcggcatcaccctggtcgagggtgagggcaagctgacc
ggtgtcgacgaggtcacggtcaacggggtggcctacaagggtcggcacatcatcctggcc
accgggtcccaggcgcgttcgctccctggtctggagatcgacggggagcggatcatcacc
agctacgaggcgctccgcttggaccgggtccccaagtccgcgatcatcctgggcggcggt
gtcatcggcgtcgagttcgccagcgtgtggcgttcgttcggcgccgaggtgacgattgtc
gaggcgctgccgcacctggtcccggcggaggaggagtccagctccaagctgctggagcgg
gcgttccgcaagcgcgggatcaagttcgagctgggcagcccgtttgagagcgtgaagctc
accgagaccggggtgagcatgacgctggcgagcggcaagaccgtggaaggcgagctgctg
ctggtggcggtgggccgcggtccggtctcccaggggctgggctacgaggaggtcggcatc
cgcctggagcgcggcttcgtccaggtcgatgagaacctgcacaccggagtcggcaacatc
tacgcggtgggcgacttgatccccacgccgcagttggcgcacgtcggctttgccgagggt
attttcgtcgccgagcacattgccgggctgaacccggtgaacatcgactacgacggtatt
ccgcgggtcacctactccgacccggaggtggcgtccgtggggatcacctccaagaccgcg
gccgaacgcgggatcgagaccaccgagttcgtctacaacttggcgggcaacgggaagagc
cagatcctgcagacccagggcgcggtcaaggtcatcgcggccaaggacggcccggtgctg
ggtgtgcacatggtgggcagccgcgtcggcgagctgatcaccgagggccagctgatctac
aactgggaggcgctgccgtctgaggtggcgcagctcatccacgcgcatccgacccagtcc
gaggcgttgggcgaggcccacttggcgctagcgggcaagccgttgcacgtccacgactga

DBGET integrated database retrieval system