KEGG   Thermobifida fusca: Tfu_0995Help
Entry
Tfu_0995          CDS       T00265                                 

Definition
(GenBank) leucyl aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00480  Glutathione metabolism
tfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tfu_0995
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     Tfu_0995
Peptidases [BR:tfu01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   Tfu_0995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: AAZ55033
UniProt: Q47R84
Position
complement(1168037..1169536)
Genome map
AA seq 499 aa AA seqDB search
MSTSLEVKSESPRSLDADAVVVGYHSGDDGLVPASGASEVDSAFSGGLGSALALLGATGA
VEEVRTVPSLGAVAAPVVVAVGLGPAPADGASVSADVVARAAGAALRALRGKSRVVVALP
ADTGELAAAAALGAVLGSYSFDRYRTGSTKEPVSSVTVVSGAADAAEAVQRATVVASAVC
LARDLVNTAPADLRPADFAGIAEQVSRDHGLDITILDEKALAEGGYGGLIGVGQGSSSPP
RLVRLSYSHPEATTTLALVGKGMTFDSGGLSLKPSSAMEWMKSDMGGAAAVLAAMRAIAE
LRVPVNVVGYLAIAENMPSGTAQRPSDVLRIYGGKTVEVLNTDAEGRLVMADALVRAQED
NPDLIVDVATLTGAQLVALGTRVFAVMANDDAVRDQVVAAATSAGEAAWPMPLPEELRKG
LDSSVADIANVAGERWGGMLSAGVFLKEFIADGVKWAHLDIAGPAFNQGEPHGYTPKGGT
GAATRTLVRLAESLAQRAE
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgtcgctggaagtcaaatccgaatccccacgttcgctcgatgctgacgcggtc
gtcgtcggctaccactcgggagacgacggcctcgtgccggcgtcgggtgcttccgaggtc
gattccgctttttctggcggactcggctcggccctggccctgctgggtgccaccggagcg
gtggaggaggtgcgtactgtcccgtccctgggcgctgtggcggcccccgtggtggtcgcg
gtcgggctgggaccggccccggcggacggtgcatcggtctccgctgacgtcgtggcgcgc
gccgcgggtgccgcgctgcgtgccctgcgcggcaagtcccgggtggtggtcgcactgccc
gcggacaccggtgagctggccgctgccgcggcgctcggcgctgtgctgggcagctattcc
tttgaccgctaccgcacgggttccacgaaggagccggtgagctcggtgactgtggtcagc
ggggctgcggacgcggctgaggcggtgcagcgcgccacggtggtggcttccgcggtctgt
ctcgcccgcgacctggtgaacaccgcgcccgcggacctgcgtcccgccgacttcgcgggg
atcgccgagcaggtcagccgggaccacggcttggatatcacgatccttgacgaaaaggcg
ctggccgagggcggttacggtggtctgatcggtgtcggccaggggtcgtccagcccgccg
cgtctggttcgcctgtcctacagccacccggaggcgacgacgacgctggcgctggtcggc
aaaggcatgaccttcgactccggtgggttgtcgctgaagcccagctccgcgatggagtgg
atgaagtccgatatgggcggcgcggccgcggtgctggccgcgatgcgcgcgatcgccgag
ctgcgggtgccggtgaatgtggtcggctatctcgcgatcgccgagaacatgccgagcgga
accgcgcagcgtccgtctgacgtgttgaggatctacggcgggaagaccgtggaggtgctc
aacacggacgcggaaggccgcctggtgatggcggacgcgctggtgcgcgcccaggaggac
aatcctgatctgatcgtggacgtggccacgctcaccggggcgcagctcgtcgcgttgggg
acccgcgtgttcgcggtgatggccaacgacgacgcggtgcgcgaccaggtggtggctgct
gccacgtccgcgggtgaggcggcctggcccatgccgctgcccgaggagctgcgcaaggga
ctggactcgtcagtcgccgatatcgccaatgtcgcgggtgagcgctggggcggcatgctc
agcgccggcgtgttcctcaaggagttcatcgcagacggagtcaagtgggcgcacttggac
atcgccgggccagcgttcaaccagggtgaaccccacggttacacgcctaagggaggcacc
ggcgcagcgacacgcacccttgtccgtctcgccgagtctctcgctcaaagagccgaataa

DBGET integrated database retrieval system