KEGG   Thermobifida fusca: Tfu_0996Help
Entry
Tfu_0996          CDS       T00265                                 

Definition
(GenBank) cobalamin-5'-phosphate synthase
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
tfu  Thermobifida fusca
Pathway
tfu00860  Porphyrin and chlorophyll metabolism
tfu01100  Metabolic pathways
Module
tfu_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tfu_0996
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     Tfu_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS
Motif
Other DBs
NCBI-ProteinID: AAZ55034
UniProt: Q47R83
Position
complement(1169743..1170504)
Genome map
AA seq 253 aa AA seqDB search
MSGMLRDCADGLRMALGTLTAIPVPVSRVDRRVAGWAMAAAPLVGVLLAAVSGAVLAGAL
WAGVSPLLAAVAAVGAVALLTRGLHWDGLADVADGLGSGADADRALAVMKRSDIGPFGVI
TLVFVVLLQVAAVAALAEEGTGAAVAGLAAALVSGRLAITWACTRLVGAARPEGLGAFVS
GTVPYPAAAAVTCVVLAVGLVEWTWCAAVAAGLVVAGGVLVWVCRRLGGITGDVLGALVE
SAAGAALVTAAAL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggatgctgcgggactgtgcggacgggctgcggatggcgctgggcacgttgacg
gcgatcccggtgccggtgtcccgggtggatcgccgggtggcgggctgggcgatggccgcg
gcgccgttggtgggggtgctgttggctgccgtgtccggggccgtgctggcgggggcgctg
tgggcgggcgtgtctccgctgctggccgcggtggcggcggtgggcgcggtggcgttgctg
acgcgcggtctgcactgggacgggctggcggatgtggccgacgggttggggagcggggcg
gacgcggaccgggcgctcgcggtcatgaagcggtccgatatcggcccgttcggtgtgatc
accctggtgttcgtggtgctgctccaggtggcggcggtggcggcgctggcggaggagggg
acgggggcggcggtggccgggttggctgccgcgctggtgtcggggcggttggcgatcacg
tgggcgtgcacgcggctggtgggtgcggcacggccggagggtttgggcgcgttcgtgtct
ggtactgtgccctatcccgccgccgccgcggtcacgtgcgtggtgctggccgtgggcctg
gtggagtggacgtggtgtgcggcagtggctgcgggtctggtggtggcgggcggagtgctg
gtgtgggtgtgccgtcggttgggcgggatcaccggtgatgtgttgggtgcgctggtggag
agcgccgccggggccgcactggtcaccgcagcagccctgtaa

DBGET integrated database retrieval system