KEGG   Thermobifida fusca: Tfu_0999Help
Entry
Tfu_0999          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_27 AAA_23 SMC_N AAA_29 SbcCD_C AAA_21 Staph_opine_DH AAA_15
Motif
Other DBs
NCBI-ProteinID: AAZ55037
UniProt: Q47R80
Position
complement(1172005..1175508)
Genome map
AA seq 1167 aa AA seqDB search
MRIERLDLLAFGPFTDLSLPLGAPGVHIVYGPNEAGKSTALRALHDLFYKIPKQTPYDFV
HDKPDMKLRAVVRSDDGRVVEFVRHKRDKNSLTDPRGNPLDESVVQRLLGGVSSSTFLSM
FALTLEELERGGESLLEGGGDVGEALLSARAYPQLRALVERLRKQRDALFRPQGRRGPTI
NKELGEYQDLNRRIGEAQLRIADYRRRLAAVAEQRQREKDLDQKLASLREEQKRWTALQQ
ALPALHTRAQQVRRIAELEAEGPLAPLDFADRLPRLEEQSRAAEETLADSTAELAAKQEE
LDRLVVDARLLDAAPEVERLARSRERIEADEERLAALERQAARLREEAREILQEVRPDPA
GADGPAVPAVDQATRNRVRELADAYADLLPRVEEARGEVAQQRRRHTAEQERLDALPDPG
DSAALAAALDALPATLFDEMTAAADTVHETAAALERIARDAGWDPADCAALAAAHAPLRD
QVVAYRRRADEHAQTQRRADEECAQVRAELTRERLRLAELTQDETVPTEEALAEARRQRD
ALWQRVRDGSDAEAADAYERAVRDADELADRALAGAQRIAERQQARQQITVLEHRLALAE
REAAAARAAGEELAAQWQALWPDPLLPAPDVDAAETVLDRLAELRRRQEEHTAACRKLAD
RRERAAAHADQLRRALRDAGAEVPEAAEDADVEAVVRELRERAAAERARREQAAQERADQ
ERTVQEAKRSLVEAEAKLDAVTERLRAWEEEWRTVVASVPVSGDRLPKEVLHDLDQCAEA
ASRLAEADQRAAEAEELREQIAAFHDRVGAVLEACGLPVPDSAAQRHAALDALRHRVAEN
SAQEQRRQALSEEVEALRGKARSAQARLEAVEAECAQMCQETGVDSVAELRAAIDRAQQV
RELRHDVALVERSLAESWPGGVAEAEQAAAGVDREELAGRLAELGQEIAAAEEEHRAAVR
DLAEAERELGEADGSALAAQAAQEREEVLARIAQNAETHTRLVLAHTLLLRCIEEYRQAH
QGPLLRRAEELFRQLTVGRFRELQTETADDGTTVLRVRRATGKLVDMGALSEGTRHQLYL
ALRLATVEHYAAEHQSMPFVLDDVFMTFDDERAAAGLRVLESVADRVQPVVLTHHAHLAE
LARDVLPEDRVHVHRLPRFTHAERVTV
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
gtgaggatcgaacgcctggacctgctggctttcggaccgttcaccgatttgtcgttgccg
ctgggcgcccccggggtgcacatcgtctacggccctaacgaagcggggaagagcaccgcg
ctgcgcgcgctccacgacctgttctacaagattcctaaacagaccccctacgacttcgtg
cacgacaaaccggacatgaagctgcgggctgtggtccgcagcgacgacggcagggtcgtg
gagttcgtccgccacaagcgcgacaagaactcgttgactgatccgcgggggaatccgctg
gatgagagcgtggtgcagcggctgctgggcggggtgagcagctcgacgttcctctccatg
ttcgcgctcactctcgaggagcttgagcgcggcggggagtcgctgttggaagggggcggc
gacgtcggtgaagcgttgctgtccgctcgcgcctacccccagttacgcgctttggtggaa
cggctgagaaagcagcgggacgcgctgttccgcccgcaggggaggcgggggccgacgatc
aacaaggagctgggcgaataccaggatctgaacaggaggatcggggaggcgcagcttcgt
attgcggactaccggcgcaggctggccgccgttgcggaacagcggcagcgggaaaaggac
ctggaccagaagctggcgtccctccgtgaggagcagaaacggtggaccgccctgcagcag
gcgcttcctgccttgcacacgcgtgctcagcaggtgcggcggatcgcggagctggaagcc
gagggcccgctcgcccccctggatttcgccgaccggctcccccgtttggaggagcagtcc
cgtgctgccgaggagacgctcgcggacagcacggccgagctcgcggccaagcaggaggag
ctggaccggctggtggtggatgcgcgcctgctggacgcggccccggaggtggagcggctg
gcccgttcccgggagcggatcgaagccgacgaagagcggctcgctgcgttggaacgccag
gcggcgcgcctgcgggaggaggcgcgggagatcctgcaggaggtgcgccccgacccggcc
ggggcggacggtcccgcggtgcctgccgtggaccaggccacgcggaaccgggtgagggag
ctcgcggacgcttatgccgacctgcttccccgcgtggaggaggcccgcggggaggtggcg
cagcagcgccgccgccacaccgccgagcaggagcggttggacgcgctgcctgacccgggc
gacagcgctgcgctggctgccgcgttggatgcgctgcctgccacgctgttcgacgagatg
actgccgcggccgacacggtgcatgagaccgccgctgccttggagcgcatcgcacgggac
gcgggctgggatcccgcggactgtgccgcgttggctgccgcgcacgccccgctgcgggac
caggtggtcgcctaccggcggcgcgcggacgagcatgcgcaaacacagcggcgcgccgac
gaggagtgcgcccaggtgcgtgcggagctgacgcgggaacggctccggttggcagagctc
acccaagacgagacggttcccaccgaggaggcgttggcggaggcccgccggcagcgggac
gcgctgtggcagcgggtccgcgacggctcggatgcggaggcggcggacgcctacgagcgc
gcggtccgcgacgcggacgagctcgctgatcgggctttggccggggcgcagcggatcgcg
gaacgccagcaggcccggcagcagatcaccgtgttggagcaccgcttggcgctggcggag
cgcgaggccgcggccgcgcgtgcggccggggaggagctcgcggcgcagtggcaggcgttg
tggcctgacccgctgctgcctgccccggacgtggatgcggcagaaacggtgctggaccgg
ctcgccgagctgcgcagacgccaggaggagcatacggcggcctgccgcaagctggcggat
cgccgggagcgggccgcggcccacgccgaccagttgcgccgggcgctccgcgacgcgggg
gccgaggttccggaggctgcggaggacgcggacgtggaggcggtggtgcgggagctgcgg
gagcgggccgccgcggaacgcgcccgccgcgagcaggccgcgcaggagcgcgccgaccag
gagcggaccgtccaggaggcgaaacggtccctggtggaggccgaggcgaagctggacgcg
gtcaccgagcggttgcgcgcctgggaggaggagtggcgcacggttgtggcgtcggtgccc
gtgtccggggaccggctgcctaaggaggtgctgcacgacctcgaccagtgcgcggaggcg
gcgtcccggctcgccgaggccgaccagcgggccgcggaggcggaggagctgcgcgagcag
atcgctgctttccacgaccgggtgggcgcggtgctcgaggcctgcggcctgcccgtgccg
gacagtgctgcccagcggcacgctgccctggacgcgctgcggcaccgggtggcggagaac
agcgcgcaggagcagcggcgccaggcgctgagtgaggaggtggaggcgctccgcgggaag
gcgcgcagcgcccaggcccggttggaggcggtggaagccgagtgcgcgcagatgtgccag
gagacgggcgtcgattcggttgcggagctgcgggcggcgatcgaccgcgcccagcaggtg
cgggagctgcggcacgatgtggcgctggtggagcggtcgctcgccgagtcgtggccgggc
ggggtcgcggaggcggagcaggctgcggccggggtcgaccgggaggagctggcgggccgt
ctggcagagctgggccaggagattgccgcggcggaggaggagcatcgcgccgcggtgcgc
gacttggctgaagcggagcgggagctgggggaggctgacgggtcggcgctggccgcgcag
gccgcccaggagcgggaggaggtgctggcccggatcgcccagaacgcggagacccatacg
cggctggtgctcgcgcacacgctgctgctgcggtgcatcgaggagtaccggcaggcccac
cagggcccgctgctgcgccgggccgaggagctgttccggcagctcaccgtgggccggttc
cgcgagttgcagacggagacagccgacgacggcacgaccgtgctgcgggtccgccgcgcc
acggggaagctggtggacatgggggcgttgagcgagggcacccggcaccagctctatctg
gcgctgcggttggcgaccgtggagcactatgcggccgagcaccagtccatgccgttcgtg
ctcgacgacgtgttcatgacgttcgacgacgagcgggctgcggccgggctgcgggtgctg
gagtcggtggcggaccgggtccagccggtggtgttgacccaccacgcccacctggctgag
ctggcccgcgacgtgctgccggaggaccgggtgcacgtccaccgcttgccgcggttcacc
cacgcggaacgcgtgaccgtgtga

DBGET integrated database retrieval system