KEGG   Thermobifida fusca: Tfu_1002Help
Entry
Tfu_1002          CDS       T00265                                 

Definition
(GenBank) hedgehog/intein hint, N-terminal
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PT-HINT Toxin-deaminase Intein_splicing Hom_end_hint Hint_2 Vint
Motif
Other DBs
NCBI-ProteinID: AAZ55040
UniProt: Q47R77
Position
1177487..1179331
Genome map
AA seq 614 aa AA seqDB search
MLRRIHDPERGASFTEYAGVLVLAAAIVAVLAFSGIAARVAETVDSAVAAILGGDPMDAP
EGDGTTPSGGGGVTPDGSGEGAGQPGTPDSPPENAPADGTGSDEGTIVPTGGGGSGPTAA
DQNTGGGLLDTISQGLKDVGTGIWDAGADFVTGIKDDAVGLWEGAKKLWNDPGQWFSDAK
DSIVEGAKNTWNQVTTDPGGFFLDLLVSDEVQEDWKNGDKTHAVAQGIAENLIGLIPGVG
WYKKGNRALNVMGGKDRGSETTPGPVRADGDQPGDNRRSDDETTRPPARPCRGNSFVPGT
LVLLADGTYAPIETITVGDDVWAFDPRTGTEGPRTVTDLHTSHSTTTLVELTVDDGTEHG
GVVVATDAHPFWVPSLATWVAAIDLEPGTWLRTSAGTWVQVRAVAVRTAEAQRVHNLTVA
DLHTYYVAAGAADALVHNEAGCIDKSHPIEVEAGPEAAQEWRKRWEEQGQALSHRRNVAV
ADIRIDGFNAGQLVSVSGQNGRPGTVELPANPRYTPKPDINRDGSVGNTREYETERKILE
HVAQQLNPRNPDGSITAPRTDITGEIHLYTELPPCHSCGRAPSGDDPGGIIEQFKREFPN
IDVKVTYGDGQTYP
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtgctcagacggattcacgacccggaacggggagcatcgttcacggaatatgccggggtc
ctcgtgctggccgcggcaatcgtggccgtcctggcattctccggtatcgcggcacgcgtc
gctgaaacagtcgactccgcggtagcggccatcctcggcggcgaccccatggacgcccct
gagggagacggcaccaccccgagcgggggagggggcgttacgccggacgggtccggggaa
ggggctggccagcccggcacaccggactccccgccggagaacgcgcctgcggacggcacc
ggctctgacgagggcaccatcgtgcccacggggggtggaggcagcgggccgaccgcggcc
gaccagaacaccggtggcggactcttggacacgatcagccaagggctgaaagacgtcggc
accggcatctgggacgcgggcgccgacttcgtcaccgggatcaaagacgacgccgtcggc
ctgtgggaaggcgccaaaaaactgtggaacgacccggggcagtggttctcggacgccaaa
gacagcatcgtcgaaggcgccaagaacacctggaaccaggtgaccaccgaccccggcggg
ttcttcctcgacctgctcgtcagcgatgaggtccaagaagactggaagaacggcgacaag
acgcatgccgtcgcccaaggcatcgcggaaaacctcatcggcctgatccccggcgtcggc
tggtacaagaaaggcaaccgggccctcaacgtcatgggcggcaaggaccgcggctccgag
accacccccggaccggtccgcgccgacggggaccagcccggcgacaaccgccgcagtgac
gacgaaaccacccggcccccggcgcggccgtgccggggcaacagcttcgtgccgggcacg
ctcgtgctgctggccgacggcacgtacgcccccatcgaaaccatcaccgtgggggacgac
gtgtgggcgttcgacccgcgcaccggcaccgaaggcccccgcaccgtcaccgacctgcac
accagccacagcaccaccaccctggtggagctcaccgtggacgacggcaccgagcacggc
ggtgtcgtggtcgccaccgacgcgcacccgttctgggttcccagcctcgccacgtgggtg
gccgccatcgacctggaaccgggcacgtggctgcggaccagtgccggaacctgggtccag
gtccgtgcggtagcggtccgcacagccgaagcccagcgagtccacaacctcaccgttgcc
gacctgcacacctactacgttgcggccggagcagccgacgcactcgtccacaacgaagca
gggtgcatcgacaagtcccaccccatcgaggtcgaagccggccctgaagcggcccaggag
tggcggaaacgctgggaagaacaaggacaggccctcagccaccggcggaacgtcgcggtc
gccgacatccgcatcgacggtttcaacgcagggcaactggtgagcgtcagcgggcagaac
ggacgtcccggcacggtagagctgcccgcaaacccccgctacacgccgaaacccgacatc
aaccgcgacggctcggtgggaaacacccgggaatacgagacggaacgcaaaatcctggag
cacgtggcacagcagttgaacccgcgcaacccggacgggagcatcaccgcgccgcgcacc
gacatcaccggggaaatccacctctacacggagcttcccccatgccattcctgcggtcgc
gccccctccggtgacgatccgggagggatcatcgaacagttcaagagagaattcccgaac
atcgacgtgaaagtcacctacggcgacgggcagacctacccctga

DBGET integrated database retrieval system