KEGG   Thermobifida fusca: Tfu_1003Help
Entry
Tfu_1003          CDS       T00265                                 

Definition
(GenBank) hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUKH_6 SMI1_KNR4 Cdd1
Motif
Other DBs
NCBI-ProteinID: AAZ55041
UniProt: Q47R76
Position
1179574..1180044
Genome map
AA seq 156 aa AA seqDB search
MGRSDSAPFDPEWFTKELMERGIATPEQITGCTPEEVAEVLAEKKDVSVPQAYVDFLRCA
GRSAGSLFQGSDIHYPDCLGINAYAEEFARDDDPGLTTEGRFFFYVHQGYAFYFFEHGKD
GVWSYVEGDGEPRKYAATFVEFLSSQLDNATRTARR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaagcgactctgcgcctttcgaccctgagtggttcacgaaagaactgatggaa
cggggaatcgccaccccggagcagatcacaggctgcaccccggaagaagtcgccgaggtg
ctcgcggagaaaaaggacgtttccgtgccgcaagcctacgtcgactttctacggtgcgcc
gggcggagcgcaggaagcctcttccaaggctccgacatccactatccggactgcctgggg
atcaacgcatatgccgaagagttcgcgcgggacgacgaccctgggctcaccacggaaggg
cggttcttcttctacgtccaccagggctacgcgttctacttcttcgaacacggcaaagac
ggcgtctggagctacgtcgaaggagacggcgagccgcggaagtacgcggccacgttcgtc
gaattcctcagcagccagctcgacaacgccacccggacggcacgccggtag

DBGET integrated database retrieval system