KEGG   Thermobifida fusca: Tfu_1008Help
Entry
Tfu_1008          CDS       T00265                                 

Definition
(GenBank) HtpX-2 peptidase. Metallo peptidase. MEROPS family M48B
  KO
K03799  heat shock protein HtpX [EC:3.4.24.-]
Organism
tfu  Thermobifida fusca
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tfu01002]
    Tfu_1008
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     Tfu_1008
Peptidases [BR:tfu01002]
 Metallo Peptidases
  Family M48: Ste24 endopeptidase family
   Tfu_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M48 Peptidase_M56 DUF4157 Pex24p
Motif
Other DBs
NCBI-ProteinID: AAZ55046
UniProt: Q47R71
Position
1183238..1184158
Genome map
AA seq 306 aa AA seqDB search
MARTRFIPDRGLTVRMATTMVLLALVYAAFVVALLWAGMPWWLVLLVVGGVALVQYFASD
RIAMAALGAREVTPQQDPELHAVVDRLCALADMPKPKVAVAHTDVPNAFATGHSRGSTMV
CVTTGLRRRLDNVELEAVLAHELSHVAHRDVAVMTVAAFLGIVAGFLVQAGTRFALLTGG
GRSREGGPAPAVIALLVVVISAIVWALSFLLTRALSRYRELSADRAAAYLTARPSALSSA
LVKISGDMARIPTQDLRQVEPFNAFFFTPALSGKGVSLSALLSTHPPTEQRLAQLAEISR
QLGRGA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgcaccaggtttatccccgaccgagggctcaccgtccgcatggcgaccaccatg
gtcctgctggccctcgtctacgcggcgttcgtggtagcgctgctgtgggccggcatgccg
tggtggctcgtcctcctcgtcgtcgggggcgtggcactcgtccagtacttcgcctccgac
cgcatcgccatggccgcgctcggcgcccgcgaagtcacgccgcagcaagaccccgaactg
cacgcggtcgtcgaccgcctgtgcgccctcgcggacatgccgaaaccgaaagtcgcggtc
gcgcacaccgacgtgcccaacgcattcgccaccgggcacagccggggaagcaccatggtg
tgcgtcaccaccgggctgcggcgccggctcgacaacgtcgaactggaagcggtgctcgcc
cacgaactgtcccacgtggcgcaccgcgacgtagctgtgatgaccgtcgccgccttcctc
ggtatcgtcgcgggcttcctcgtccaagctgggacccggttcgcgctcctcaccggcggc
ggacgcagccgggaaggcgggcctgcgcccgcggtcatcgcgctgctcgtggtcgtgatc
agcgcgatcgtgtgggcgttgagcttcctgctgacccgcgccctctcccgctaccgggag
ctgtcagccgaccgcgccgccgcctacctgaccgcccggccgtccgcgctgagcagcgca
ctcgtcaaaatcagcggggacatggcccgcatccccacccaggacttgcggcaggtcgaa
ccgttcaacgcgttcttcttcacccccgcgctgagcgggaaaggcgtcagcctcagcgcg
ctcctgtccacccaccccccgaccgaacagcggctcgcgcagctcgcagagatctcccga
cagttgggaaggggagcctga

DBGET integrated database retrieval system