KEGG   Thermobifida fusca: Tfu_1010Help
Entry
Tfu_1010          CDS       T00265                                 

Definition
(GenBank) glycerate kinase
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
tfu  Thermobifida fusca
Pathway
tfu00260  Glycine, serine and threonine metabolism
tfu00561  Glycerolipid metabolism
tfu00630  Glyoxylate and dicarboxylate metabolism
tfu01100  Metabolic pathways
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tfu_1010
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tfu_1010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tfu_1010
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     Tfu_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_kinase
Motif
Other DBs
NCBI-ProteinID: AAZ55048
UniProt: Q47R69
Position
1184840..1185931
Genome map
AA seq 363 aa AA seqDB search
MIAPDKFAGTLTAVEAAEAIADGWRSVDPDTHCTLVPLSDGGPGFVDVLHTALGGTLVAT
EATGPLGTPVQARFLLVGQTAYVESAQACGLHLLPAKDRNPETTTTYGVGELIGAAIDRG
ATTVVVGLGGSGTNDGGAGMLAALGATPAEPLRSGGGALTGLDRVDLAAARARVAGIRLI
AATDVDNPLLGAHGASAVFGPQKGADAAQVQRLDAALAHFADLTDPETTLRATPGAGAAG
GLGYGLLLLGGTVESGVRRVLGAVGLDTLVASADAVITGEGSFDSQSLRGKLPHGVAQTA
SRHGVPCVVLAGRVAVAEEEAAAAGVTAAHSLVESAGSVQAALEHSARELRRLAARVAAD
WPR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctcctgacaagttcgctggaaccctcaccgcggtcgaagcagccgaagccatc
gcagacggctggcgctccgtcgacccggacacccactgcaccctggtgccgctctccgac
ggcggccccggattcgtcgacgtgctgcacacggcgctcggcggcaccctcgtcgccacc
gaagccaccgggccgctcggcaccccggtgcaggcccgcttcctcctcgtcggacagacc
gcctacgtggaaagcgcccaagcgtgcggcctccacctgctgcccgctaaagaccgcaac
ccggaaaccaccaccacctacggggtaggggagctgatcggcgcagccatcgaccgcggc
gccaccaccgtcgtcgtcggcctgggcggcagcggcaccaacgacgggggagcgggcatg
ctcgccgccctcggcgctacgcccgccgaaccactgcggagcggcggcggtgccctcacc
ggcctagaccgcgtcgacctggccgcggcccgcgcccgcgtcgccggcatccggctcatt
gccgccaccgacgtggacaacccgctgctcggcgcccacggcgccagcgccgtcttcgga
ccgcagaaaggcgcggacgccgcccaagtccagcgcctggacgccgcgctcgcccacttc
gcggacctcaccgacccggagacgacgctgcgcgccacgcccggagccggggcagccggc
gggctcggctacggactgctgctgctcggcggcaccgtcgaatccggggtgcgcagagtg
ctgggcgcggtcggcctcgacaccctcgtggcctccgccgacgcggtcatcaccggggaa
gggtccttcgactcccagtccctgcgcggcaaactcccgcatggggtagcgcagaccgcg
tcccggcacggcgtgccctgcgtcgtcctcgccggccgggtcgccgtcgcggaagaagaa
gccgccgcggcaggcgtcaccgcagcccactccctcgtcgaatccgcgggatcagtgcag
gccgccctggagcactccgcgcgggaactgcgccgcctcgcagcccgcgtcgcagcggac
tggccgcgctga

DBGET integrated database retrieval system