KEGG   Thermobifida fusca: Tfu_1013Help
Entry
Tfu_1013          CDS       T00265                                 

Definition
(GenBank) SSU ribosomal protein S4P
  KO
K02986  small subunit ribosomal protein S4
Organism
tfu  Thermobifida fusca
Pathway
tfu03010  Ribosome
Module
tfu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tfu_1013
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tfu03011]
    Tfu_1013
Ribosome [BR:tfu03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Tfu_1013
  Archaea
    Tfu_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S4 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AAZ55051
UniProt: Q47R66
Position
1187971..1188582
Genome map
AA seq 203 aa AA seqDB search
MRYTGPKVRLSRRAGVPLTRKAVKYFEKRPYPPGEHGRRVRRSTSDYAVRQAEKQKLRWY
YDLSEKQLARVYENAKKRPGRTGEEMIAELELRLATVLLRAGFAASIYAARQFINHGHIT
VDGKKVDIPSYQVKPGQIVSVREKSRKLVPFIEAAEGVHADEKIASYLAVSHKDLTIAVV
DRPKREQVPVPFDEQLVVEYYAR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacaccggaccgaaggtacggttgtcccggcgcgctggcgttcccttgacccgt
aaggcggtcaagtacttcgagaagcgtccttacccgcccggtgagcacggccgtcgggtg
cgccgctctaccagcgactacgccgtccgtcaggcggagaagcagaagctgcgctggtac
tacgacctttccgagaagcagctggcccgcgtctacgagaacgcgaagaagcgtccgggc
cgtaccggcgaggagatgatcgccgagctcgagctgcggctggccaccgtgctgctgcgg
gcgggcttcgccgcctccatctacgcggcccgccagttcatcaaccacggccacatcacc
gtggacggcaagaaggtggacatcccctcctaccaggtcaagcctggccagatcgtcagc
gtgcgggagaagtcgcgcaagctggtcccgttcatcgaggccgccgagggcgtgcacgcc
gacgagaagatcgccagctacctggcggtcagccacaaggacctgaccatcgccgtggtg
gaccggcccaagcgcgagcaggtgccggttcccttcgacgagcagctcgtcgtcgagtac
tacgcccgctga

DBGET integrated database retrieval system