KEGG   Thermobifida fusca: Tfu_1015Help
Entry
Tfu_1015          CDS       T00265                                 

Definition
(GenBank) cytochrome c oxidase subunit II
  KO
K02275  cytochrome c oxidase subunit II [EC:1.9.3.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00190  Oxidative phosphorylation
tfu01100  Metabolic pathways
Module
tfu_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tfu_1015
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Tfu_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 COX2_TM DUF2207
Motif
Other DBs
NCBI-ProteinID: AAZ55053
UniProt: Q47R64
Position
1189200..1190144
Genome map
AA seq 314 aa AA seqDB search
MSPTRHRNRRHALRRWAPRGAVLAALAVAATGCASNEFTRLGLPEPITEQAERVVTLWQG
SWVAAFAVGILVWGLIIWSVIAYRKRSEQLPPQVRYNMPIEALYTVLPIIVVSVLFYFTA
RDQTYLLETDEPADVYVDVNAFQWSWQFTYEDELDVNGNPVSVAGVPSTSKDELPVLVLP
SDSVVHFDLEAPDVIHSFWIPAFAFKLDVIPGHPNEFQVKIKPGVEGDYEGRCAELCGYD
HSRMLFTLRVVTPEEYRAWIEEQKANPQELPAVPDLEEEAPAPNPGPATATQDSSDTAAT
ADDAATTAEEEDGQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgagtccgacccgccataggaatcggcgccacgcgctgcgccgatgggcaccacgcggc
gccgtgctcgccgcgctggctgtggccgcgaccggctgcgcgtcgaacgagttcactcgt
ctggggctgccggagccgatcactgagcaggcagagcgtgtcgtcacgctctggcagggc
tcgtgggtggcggcgttcgcggtcggcattctcgtctgggggctgatcatctggtcggtg
atcgcctatcggaagcgctctgagcagctgccgcctcaggtgcgctacaacatgcccatc
gaggcgctctacaccgttctgcccatcatcgtcgtctcggtgctgttctacttcacggcc
cgagaccagacctacctgctggagaccgacgagcccgctgacgtctacgtcgacgtgaac
gcgttccagtggagctggcagttcacctacgaagacgagctcgacgtcaacggcaatcct
gtctctgtcgccggggtcccgtccaccagcaaggacgaacttcctgtcctggtgctgccg
agcgacagcgttgtgcacttcgacctggaggctccggacgtcatccactcgttctggatc
cccgcgttcgcgttcaagctggacgtcatcccgggacacccgaacgagttccaggtcaag
atcaaacccggcgttgagggagactacgagggccggtgtgcagagctgtgcggttacgac
cactcgcgtatgctcttcaccctccgcgtagtcactcctgaggagtaccgggcgtggatc
gaggagcagaaggccaacccccaggagctgcccgcggttcccgaccttgaggaggaggct
cctgctcccaacccgggcccggccacggccacccaggactcctccgacaccgcggccacg
gctgacgatgccgcgaccacggctgaagaagaggatggtcagtag

DBGET integrated database retrieval system