KEGG   Thermobifida fusca: Tfu_1018Help
Entry
Tfu_1018          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD Big_5
Motif
Other DBs
NCBI-ProteinID: AAZ55056
UniProt: Q47R61
Position
1192486..1193838
Genome map
AA seq 450 aa AA seqDB search
MEGRAIQAARRLGVGVTAASLLFTVACSGTEEASGVRNESPTAELTIVPANGETEVRPDT
PITVTATRGTIEDVQVIQTPLPEEGSEASASPEAENTASDESEEGPSEVDTITGTLNEDK
TEWVSDWTLIPGSTVTVVAKGKSPEGDVTEFTSEFTTLAATPGKRLEIQSNFPVSGDVVG
VGMPVIINFDLPVENKAAVEAALEVISEKPTQGAWNWFGDQTVVFRTEEYWEPYQKVTVN
MRLAGVQAAEGVYGVKNYQLNFEVGRSQISEVDNDTHRMIVTRDGEQIKDFPISNGKGTT
RAYTTTSGIHLTMEKYQHLVMDSSTVGIPPGHPDYYRVDVNYAVRFSNSGEFTHAAPWNG
SLGQANLSHGCINMSTEDARWFYENSYMGDPLIVVGTDRELEVDNGWGYWQRSWEEWLAN
STLGEPDRTDEPGSPGRPHGTIGEQAEAAE
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtggagggtagagcaatccaggcggctcgccgtcttggggttggagtgacggcggcaagc
ctcctcttcaccgtggcgtgctccggtacagaagaggccagtggggtccgcaacgagtca
cccaccgcagaactcaccattgttcccgcgaacggggaaaccgaggtcaggccagacact
cccattacggtgaccgcgacccggggaaccattgaggatgtccaggtcattcagacccct
ctccccgaggagggatctgaggcctcagcttctcccgaggcggagaacactgcttccgac
gagtcggaagaaggcccgtccgaggttgacacgatcaccggcaccctgaacgaggacaag
accgagtgggtcagcgactggacgctgatccccggcagcacggtcaccgtagtggccaag
gggaagagcccggaaggggacgtcaccgagttcaccagcgagttcaccacgctcgcggct
actcccggcaagcggctggagatccagtcgaacttcccggtcagcggggacgtcgtcggt
gtgggcatgccggtcatcatcaacttcgacctgcctgtggagaacaaggctgcggttgag
gcggctctcgaagtgatctcggaaaaacccacccagggagcgtggaactggttcggcgac
cagaccgtcgtgttccgcaccgaagagtactgggagccctaccagaaagtgaccgtcaac
atgcgcttggcgggcgtgcaggccgccgagggcgtctacggggtcaagaactaccagctc
aactttgaggtgggccggtcgcagatcagcgaggtggacaacgacacccaccggatgatc
gtcacccgggatggggagcagatcaaagacttccccatcagcaacggcaagggcacaacc
cgggcctacaccaccacgtcgggcatccacctgaccatggagaagtaccagcacctggtc
atggactcctccaccgtcggtattccgccaggacaccctgactactaccgggtggacgtc
aactacgcggtacgtttctccaacagtggcgagttcacccacgccgcaccgtggaacggt
tcgcttgggcaggccaatctcagccacgggtgcatcaacatgagcaccgaggacgcccgg
tggttctacgagaactcctacatgggcgacccgctgatcgtcgtcggcaccgaccgggaa
ctggaagtcgacaacggctggggctactggcagcgctcctgggaggagtggctggccaac
agcaccctcggtgagccggaccgcaccgacgaacccggctcgccgggccgtccccacggc
acgatcggagagcaggccgaagctgcagagtaa

DBGET integrated database retrieval system