KEGG   Thermobifida fusca: Tfu_1022Help
Entry
Tfu_1022          CDS       T00265                                 

Definition
(GenBank) cytochrome c oxidase subunit III
  KO
K02276  cytochrome c oxidase subunit III [EC:1.9.3.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00190  Oxidative phosphorylation
tfu01100  Metabolic pathways
Module
tfu_M00155  Cytochrome c oxidase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Tfu_1022
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Tfu_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX3
Motif
Other DBs
NCBI-ProteinID: AAZ55060
UniProt: Q47R57
Position
complement(1197927..1198511)
Genome map
AA seq 194 aa AA seqDB search
MHGAAKRPDLVSVGTMVWLANELMFFASLFAMYFTIRSVTKGNPDLGPWPDAHLNIVLST
TITTILVASSFTAQFGVWAAERGDVKKLRKWFFISFLLGAIFIIGQGYEYYELIVHEGLT
MRSSAYGSMFFLTTGFHGLHVLGGLFAFLLVLGRTYAAKRFTHQQATSAIVVSYYWHFVD
VVWVGLFASIYLLQ
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgcatggcgctgccaagcgtcctgatctggtgagcgttggcaccatggtgtggctggcc
aacgagctcatgttctttgcgtcgctgttcgcgatgtacttcaccatccgatcagtgacc
aagggcaaccccgacctcgggccgtggccagacgcgcatctcaacatcgtgctgtccacg
accattacgactattctggtggcttcgagcttcaccgcgcagttcggcgtgtgggccgcg
gaacgtggtgacgtcaagaagctccgcaagtggttcttcatctcgttcctcctcggcgcg
atcttcatcatcggccaggggtacgagtactacgagctcatcgtgcacgaggggctgacg
atgcgttccagcgcctacggctcgatgttcttcttgaccacggggttccacggtctccac
gtcctcggcggcctgttcgcgttcctgctcgtgctgggacgcacgtacgccgcgaagcgc
tttactcaccagcaggcgacgagcgcgatcgttgtgtcctactactggcacttcgtcgac
gtcgtctgggtcggtctgtttgcgtccatctacctactccagtga

DBGET integrated database retrieval system