KEGG   Thermobifida fusca: Tfu_1024Help
Entry
Tfu_1024          CDS       T00265                                 

Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
tfu  Thermobifida fusca
Pathway
tfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01130  Biosynthesis of antibiotics
tfu01230  Biosynthesis of amino acids
Module
tfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tfu_1024
Enzymes [BR:tfu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Tfu_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AAZ55062
UniProt: Q47R55
Position
1199481..1200527
Genome map
AA seq 348 aa AA seqDB search
MSERTWSHLISALLNGTSLTADDTKWAMNEIMSGSATDAQIAGFAIALRAKGESVAEVRG
LAQGMLDHAVTISVPGATLDIVGTGGDRAHTVNVSTMASIVASAAGARVVKHGNRAASSS
CGTADVLERLGVIIDLDPADAVAVAEEVDITFCFAPLYHPSLKYAAKPRRELAVPTVFNF
LGPLTNPARPTASAIGVFDRNMCEIMAGVFAERGVNALVFRGDDGLDELTTTTTSSVWIV
ADGSVRYEQLDPADLGIPRATPEALRGGDVEFNARVVREFLDGRPGPVRDAVLLNAAAAL
AAAEGVTGSLIETLRAQYQRAAEAVDSGAAKAKLDAWVESSQARAKQL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaacgaacctggtcccacctgatcagcgcactgctgaacggcacctctctgacg
gccgacgacaccaagtgggcaatgaacgagatcatgtccggttcggccaccgacgcccag
atcgcggggttcgcgatcgcgctgcgcgccaagggcgaaagcgtcgctgaggtgcggggt
ctggcccagggcatgctcgaccacgcggtgacgatctccgtccccggcgccaccctcgac
atcgtaggaaccggcggcgaccgcgcacacacggtcaacgtctccaccatggcctcgatc
gtcgcctcggctgccggggcgcgggtggtcaagcacggcaaccgggcagcctcctcctcg
tgcggcaccgccgacgtgctggaacggctgggcgtgatcatcgacctggaccccgcggac
gcggtcgcggtggccgaagaggtcgacatcaccttctgcttcgcgccgctctaccacccc
tcgctgaagtacgcggccaagccgcggcgcgagctcgccgtgcccaccgtcttcaacttc
ctgggaccgctgaccaacccggcccggcccaccgcctccgcgatcggcgtcttcgaccgg
aacatgtgcgagatcatggccggggtcttcgccgagcgcggtgtgaacgccctcgtgttc
cgcggcgacgacgggctggacgagctcaccaccacgacgacctcgtcggtgtggatcgtc
gccgacggctctgtccgctacgagcaactggacccggcagacctgggcattccgcgggcc
accccggaagcgctgcgcggcggagacgtcgagttcaacgcccgcgtcgtccgcgagttc
ctggacggccgccccggcccggtgcgggacgcggtcctgctcaacgcggctgcggcgctc
gccgccgccgagggggtcaccggatccctcatcgaaaccctgcgcgcccagtaccagcgg
gctgcggaagccgtggacagcggcgcggccaaagcgaaactggacgcgtgggtggagagc
agccaggcccgagccaagcagctctga

DBGET integrated database retrieval system