KEGG   Thermobifida fusca: Tfu_1028Help
Entry
Tfu_1028          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NYN_YacP DUF4407 Macoilin GAS Exonuc_VII_L Spc7 PKcGMP_CC Fez1 Uso1_p115_C DUF2746 TMF_DNA_bd
Motif
Other DBs
NCBI-ProteinID: AAZ55066
UniProt: Q47R51
Position
1203684..1205033
Genome map
AA seq 449 aa AA seqDB search
MTDDSGNAEERGPEHADDETLDRPLPEAVRTRVIEYGAEILGMMLPTEIPPRLRRIAKFE
PRRRARLAGPDIAAQLEADAEFRSRVAERMRQAWPSLVAELDQGELPPAVDPVIAGAVLY
VLRPPGWAATVQQIHDELEREARAKAADDTAETLVELQTKLDEIKTQHRQEVLRLRAELR
EHKAEIAELRRKLHHERQRAKEAVRGAERSIAEAQEHSDAAAARLHAVEAENRRLRNRLA
AAEAQVENARRAARAARGAEEARLRVLLDVLQEAAQGLRRELALPASITLPADLVAAEAR
SGTAEMPGQGLPDDDPKFIDQLLTIPRIHLLVDGYNVTKTGYGDRPLADQRAKLLAGLEG
LASQTKAEITCVFDGAEIDSPIALVNSRRVRVLFSSPGETADELIIRLVRAEPEGRPVAV
VTSDKEIIAAVRREKARTVASPLLLRRLE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgattccgggaatgctgaggaacgcggaccggagcacgcggacgacgagacc
ttggaccggccgctccccgaagcggtgcgcacccgagtcatcgaatacggggccgagatc
ctcggcatgatgctcccgacggagatcccgccgaggctgcggaggatcgccaagttcgaa
ccgcgccgtcgagcgcgcctggccggacctgacatcgctgcgcaactcgaggctgacgca
gagttccgttcccgcgtcgctgagcggatgcggcaggcgtggccgtctctcgttgcggag
cttgaccagggggagctgccccccgccgtggacccggtcatcgccggggccgtcctctac
gtgctgcggcccccagggtgggcggcaaccgtccagcagatccacgacgaactggagcgc
gaagcccgggccaaagccgcggacgacaccgcggaaaccctcgtcgaactgcagaccaaa
ctggacgagatcaaaacccagcaccgccaggaagtcctccggctccgcgcggagctgcgg
gagcacaaagcggagatcgcggagctgcgccgcaagctccaccacgagcgccagcgcgcc
aaagaagcggtccgcggcgcagagcgttccatcgccgaagcccaggagcacagtgacgcc
gccgcggcccggctgcacgccgtcgaagcggagaaccggaggttacgcaaccggctcgct
gccgcggaagcccaagtggagaacgcccgccgggcggcccgcgcggcgcgcggcgccgaa
gaagcccgcctgcgggtgctgttagacgtgctccaagaagccgcgcaaggactgcgccgc
gaactggccttgcccgcgtcgatcacgctccccgccgacctcgtggccgccgaagcgcgg
tcaggcaccgcggagatgccggggcagggcctgccggacgacgaccccaagttcatcgac
caactgctgacgatcccgcggatccacctgctcgtcgacggctacaacgtcaccaagacc
ggctacggtgaccggccgctcgctgaccagcgcgccaagctgctcgccggtctggaaggg
ctcgcgtcccagaccaaagccgagatcacgtgcgtgttcgacggcgcggaaatcgactcc
ccgatcgcgctggtgaattcccgtcgggtccgcgtgctgttcagcagtcccggggagacc
gccgacgaattgatcatccggctggtgcgggccgaaccggaagggcggcccgtggccgtg
gtcacctcggataaagagatcattgcggcggtacggcgggaaaaagcgcggaccgtcgcg
tcccccctgctcctccgccgtttggaatga

DBGET integrated database retrieval system