KEGG   Thermobifida fusca: Tfu_1029Help
Entry
Tfu_1029          CDS       T00265                                 

Definition
(GenBank) putative secreted protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NLPC_P60 OEP IncA Mod_r DUF2968 BLOC1_2 Seryl_tRNA_N Exonuc_VII_L AAA_13 LMBR1 DUF3450 Peptidase_C92 HemX Uso1_p115_C DUF4201 Sec2p T3SSipB Jnk-SapK_ap_N Sec34 Bap31 LRAT IFT57 ATG16 DivIVA CENP-F_leu_zip CCDC106 OmpH FemAB DUF1664 ZapB Laminin_II
Motif
Other DBs
NCBI-ProteinID: AAZ55067
UniProt: Q47R50
Position
1205259..1206254
Genome map
AA seq 331 aa AA seqDB search
MTSQGGRRAARRIATGLGFVAASSLVLPHGTAHAEPTKEEVEAKLEELHEEASALVDEYN
AAKEEYDAAKEKVEELEKQLGDEEERYEELREKVSSFASAAYMSPDLEAVTTILSVEDPA
DILEQSADLSYLSETQRAELEEFSNSSERLIQLKEENEELLKEAEEKKEEVEKKQKEVEE
KIEEQEALLAQFPDADPLTSGSSSTGGTYTGPASGNARTALDFAYAQLGKPYIWGGTGPD
GYDCSGLTMRAWGAAGVSLPRTTYAQATVGTRVSYNSMQPGDLVFFYPELSHVGLYVGNG
QMIHAPSSGRTIEVVSLSGYWSQHFQFAVRP
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactagtcaaggtggacggcgcgcggctcgtcgaatcgcgaccggacttggtttcgta
gcggcaagcagcctcgtgctgcctcatgggaccgcgcatgctgagccgaccaaagaagag
gtcgaagccaagctcgaagaactccacgaagaggccagcgccctcgtcgacgagtacaac
gcggccaaagaggaatacgacgctgccaaggaaaaggtcgaagagctcgaaaagcagctc
ggggacgaggaggagcgctacgaggagctgcgggagaaggtctccagcttcgccagcgcc
gcctacatgtcccccgacctggaggcggtgacgacgatcctctccgtggaggacccggcg
gacatcctggagcagtccgcggacctcagctacctctccgagacccagcgggcggaactt
gaggagttctccaactcttccgagcggttgatccagctcaaggaggagaacgaggagctg
ctcaaggaagccgaggagaagaaggaagaggtcgagaagaagcagaaggaagtcgaagag
aagatcgaagagcaggaggccctgctcgcccagttcccggatgccgacccgctcacctcg
ggctccagctcgactggcggcacgtacaccggtcctgcttccggcaacgcccgcaccgct
ctcgacttcgcctatgcccagctcggcaagccctacatctggggcgggaccggtccggat
ggctacgactgctccgggctgaccatgcgcgcctggggtgcggccggggtgagcctgccg
cgcaccacgtacgcgcaggccaccgtcggcacccgggtcagctacaacagcatgcagccg
ggcgacctcgtcttcttctaccccgagctgagtcacgtgggactgtacgtgggcaacggg
cagatgatccacgcccccagctcgggacggaccatcgaggtggtctccctttccggctac
tggagccagcacttccagttcgcggtgcgcccgtag

DBGET integrated database retrieval system