KEGG   Thermobifida fusca: Tfu_1037Help
Entry
Tfu_1037          CDS       T00265                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tfu  Thermobifida fusca
Pathway
tfu00010  Glycolysis / Gluconeogenesis
tfu00030  Pentose phosphate pathway
tfu00051  Fructose and mannose metabolism
tfu00052  Galactose metabolism
tfu00680  Methane metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_1037
   00030 Pentose phosphate pathway
    Tfu_1037
   00051 Fructose and mannose metabolism
    Tfu_1037
   00052 Galactose metabolism
    Tfu_1037
  Energy metabolism
   00680 Methane metabolism
    Tfu_1037
Enzymes [BR:tfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tfu_1037
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tfu_1037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AAZ55075
UniProt: Q47R42
Position
1214880..1215905
Genome map
AA seq 341 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVVRKGIKEYGYEFVGFRDGWRGPLEGDTMPLDIEAVRGI
LPRGGTILGSSRTNLMKIEGGVERVKDNMAALGVDALVAIGGEDTLGVARQLHDHGVNVV
GVPKTIDNDLNATDYTFGFDTAVNIATEAIDRLHTTAESHHRALVVEVMGRHAGWIALHA
GMAAGANVILIPERPFDIDEVVAYIESRFKTNYAPIIVVAEGAHPKEGQLTLASAERDSF
GHVRLGGIGQRLAEEIEARTGKEARSVVLGHVQRGGTPSAFDRVLATRLGLHAITAVHDK
DFGKMVALRGTEIVRVDLSEATDQLKTVPVERYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtcggggtactgaccgggggtggcgactgcccgggcctgaacgcggtcatccgt
gcggtggtccgtaagggcatcaaggaatacggatacgagttcgtcggattccgtgacggg
tggcgcggccccctggaaggcgacaccatgccgctggacatcgaggcggtccgcggcatc
ctcccgcgcggcggtaccatcctcggctcctcgcgcaccaacctcatgaagatcgagggc
ggtgtcgagcgggtcaaggacaacatggccgcgctcggggtggacgcgctcgtcgcaatc
ggcggtgaggacaccctcggcgtcgcgcgccagctccacgaccacggtgtcaacgtggtc
ggtgtgcccaagaccatcgacaacgacctcaacgccaccgactacaccttcggcttcgac
actgcggtcaacatcgcgaccgaggccatcgaccgcctgcacaccaccgccgagtcgcac
caccgtgccctggtcgtcgaggtcatgggccgccacgcgggctggattgcgctgcacgcg
ggcatggcggccggcgccaacgtcatcctgatccccgagcgcccattcgacatcgacgag
gtcgtcgcctacatcgaaagccgcttcaagaccaactacgcgccgatcatcgtggtcgcc
gagggcgcccacccgaaggagggccagctcaccctggccagcgcggaacgcgactccttc
ggccacgtccgcctcggcggcatcggccagcgcctcgccgaagagatcgaggcgcgcacc
ggcaaggaagcccgctcggtggtcctgggccacgtgcagcgcggcggtacgccgtccgcc
ttcgaccgggtgctggccacccggctgggcctgcacgccatcaccgcggtccacgacaag
gacttcggcaagatggtcgccctgcgcggcaccgaaatcgtccgcgttgacctgtccgaa
gccaccgaccagctcaagactgtcccggtcgagcggtacgaggaagccgaagtcttcttc
ggctaa

DBGET integrated database retrieval system