KEGG   Thermobifida fusca: Tfu_1040Help
Entry
Tfu_1040          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_molyb
Motif
Other DBs
NCBI-ProteinID: AAZ55078
UniProt: Q47R39
Position
1218724..1219326
Genome map
AA seq 200 aa AA seqDB search
MSERRLPPGQYVPNEWPAVHYGPVPKFRPHRWDLQVYGATADGTQYRWDWTEFQTLPRVD
VVTDFHCVTRFTKLDVRWRGVAASTVLKLAPPAEDATHVMVWAEYGYSANLPLDDFRRPD
VILATHRDGKPLEPQHGYPVRLVVPHRYGWKSVKWVRAIEYLTADRRGFWEERGYHNLAN
PWLEQRYSYQEDPGDGPPLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgagcgacggctgccgccagggcagtacgtgccgaacgaatggcctgctgtgcac
tacggcccggtaccgaaattccgcccgcaccgctgggatctgcaggtctacggagccaca
gcggacgggacgcagtaccggtgggactggaccgagttccagaccctgccgcgcgtcgac
gtggtcaccgacttccactgtgtgaccagattcaccaagctcgacgtgcggtggcgcggg
gtggccgcctccaccgtgctgaaactcgcaccccccgccgaggacgccacccacgtcatg
gtctgggcagagtacggctacagcgccaacctgcccctcgacgacttccggcgtcccgac
gtcatcctcgccacccaccgcgacggcaagccgctggaaccccagcacggatacccggtg
cggctcgtcgtcccccaccgctacggctggaagagcgtgaaatgggtgcgcgccatcgaa
tacctcaccgcggaccggcgcggcttctgggaggagcgcggctaccacaacctcgccaac
ccgtggctggagcagcgctactcctaccaggaggaccccggggacgggccgccgctggac
tga

DBGET integrated database retrieval system