KEGG   Thermobifida fusca: Tfu_1047Help
Entry
Tfu_1047          CDS       T00265                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tfu  Thermobifida fusca
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: AAZ55085
UniProt: Q47R32
Position
complement(1224899..1225834)
Genome map
AA seq 311 aa AA seqDB search
MPKINTMGEDLRAERVIATTGATGAVGGKVAAQLARLGLAQRLIVRDLNRAPELPKSSAV
LAAYEDPAAFGRAVRGAEVLFLVAADHAENREELHRAVIDAAVAEGVRHIVYLSFLNASA
AATCVLGREHYATEEYLRTTGVVYTFLRPSLYLDLLPEWIGEDGTIRGPAGEGTVAWVSR
DDVADVAAAVLRAPEEHVNRIYNVTGPEAVSLGQTATRLSTLTGRTIVYVPQTPEEAIDF
LSSQGLTAREIAERVSACTAIAAGELSTANRTVLRLTGHPARSLEGYLRKNPSALSHAPL
FSGSGSALGPR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
ttgccgaagataaacactatgggtgaggatctgagagcggaacgtgttatcgcgacgact
ggggcgaccggagccgtcggcggcaaagtagccgcccagttggcacggctgggccttgcg
cagcggctcattgtccgtgacctcaaccgcgcccccgaactcccgaagtcgagcgcggtc
ctggccgcctacgaggatcctgccgctttcggccgcgcagtccgcggcgccgaggtgctg
ttcctcgtcgccgcggaccacgcggagaaccgcgaggaactccaccgggccgtcatcgac
gcggccgtggccgaaggggtgcgccacatcgtctacctgtcgttcctcaacgcgagcgcc
gccgcgacctgcgtcctcggccgggagcactacgccaccgaggagtacctgcgcaccacc
ggggtggtctacaccttcctgcggcccagcctgtacctggacctcctgcccgagtggatc
ggcgaggacggcacgatccgcggcccggccggggaaggcaccgtggcgtgggtgtcgcgg
gacgatgtcgccgacgtcgccgccgctgtgctgcgcgccccggaagagcacgtcaaccgc
atctacaacgtgaccggtccggaagccgtctcgctggggcagaccgcgacccgcctgtcc
acgctcaccggacgcaccatcgtctacgttccgcaaaccccggaggaggccatcgacttc
ctctcctcgcaggggttgaccgcccgggaaatcgcggagcgggtgagcgcctgcacggcg
atcgccgccggggaactcagcaccgccaaccgcaccgtactgcggctgaccggccaccct
gcccgctccctcgagggctacctgcggaagaatccgagcgcgctgtcccacgcgccgctc
ttcagcggctccggtagcgcgctcggcccccgctga

DBGET integrated database retrieval system