KEGG   Thermobifida fusca: Tfu_1050Help
Entry
Tfu_1050          CDS       T00265                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
tfu  Thermobifida fusca
Pathway
tfu00670  One carbon pool by folate
tfu01100  Metabolic pathways
tfu01120  Microbial metabolism in diverse environments
tfu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Tfu_1050
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     Tfu_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AAZ55088
UniProt: Q47R29
Position
complement(1227059..1227997)
Genome map
AA seq 312 aa AA seqDB search
MLGSPTPRPAPRPRRISELLARKEPTFSFEFFPPKTPEGERMLWRAIREIEALRPSFVSV
TYGAGGSTRDRTVNVTEKIATNTTLLPVAHITAVNHSVRELRHLIGRFAAAGVCNMLALR
GDPPGDPLGEWVKHPEGLTHAEELVRLIKESGDFCVGVAAFPYKHPRSPDVETDTDFFVR
KCRAGADYAITQMFFEAEDYLRLRDRVAARGCDVPIIPEIMPVTKFSTIARSEQLSGAPF
PRRLAEEFERVADDPEAVRALGIEHATRLCERLLAEGAPGIHFITFNRSTATREVYHRLV
GATQPAAVAALP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgctcggatcacccacgccgcgcccggcgcctcgtccgcgccgtatcagcgaactgttg
gcgcgtaaagagcccacgttctccttcgagttcttccccccgaaaacgcccgagggggag
cgcatgctttggcgggcgatccgggagatcgaggccctacgcccttccttcgtctcggtg
acctacggtgcgggcggcagcacccgggaccggaccgtgaacgtcaccgagaagatcgcc
accaacaccactctgctgcccgtggcgcacatcaccgcggtcaaccactcggtgcgggag
ctccgccacctcatcggccggttcgcggcggcgggggtgtgcaacatgctcgcgctgcgc
ggcgacccgcccggcgacccgctgggcgaatgggtcaagcacccggagggcctcacccac
gccgaagaactggtgcggctgatcaaggagagcggtgacttctgcgtcggggtggccgca
ttcccctacaagcacccccgctcccccgacgtggagaccgacacggacttcttcgtccgc
aaatgccgggcaggagcggactacgcgatcacccagatgttcttcgaagccgaggactac
ctgcggctgcgggaccgggtcgcggcccggggctgcgacgtgcccatcatccctgagatc
atgccggtcacgaagttcagcacgatcgcccgctccgagcagttgtcgggagcgccgttc
ccccgcaggctggcggaagagttcgaacgggtcgccgacgaccccgaggcggtgcgcgcg
ctcggtatcgagcacgccactcggctgtgcgaacggctcctcgccgaaggggcgccgggc
atccacttcatcacgttcaaccgttcgacggcgacccgcgaggtctaccaccggctcgtg
ggcgccacccagccggcagcggtagctgcgctgccatga

DBGET integrated database retrieval system