KEGG   Thermobifida fusca: Tfu_1057Help
Entry
Tfu_1057          CDS       T00265                                 

Definition
(GenBank) carbamoyl-phosphate synthase large subunit
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
tfu  Thermobifida fusca
Pathway
tfu00240  Pyrimidine metabolism
tfu00250  Alanine, aspartate and glutamate metabolism
tfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tfu_1057
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tfu_1057
Enzymes [BR:tfu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     Tfu_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS ATPgrasp_Ter Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 GARS_A ATP-grasp_4 ATP-grasp_2 RimK DUF3071
Motif
Other DBs
NCBI-ProteinID: AAZ55095
UniProt: Q47R22
Position
1234769..1238080
Genome map
AA seq 1103 aa AA seqDB search
MPRRTDLSSVLVIGSGPIVIGQACEFDYSGTQACRVLKAEGLRVILVNSNPATIMTDPEF
ADATYVEPITPEMVEKIIAKERPDALLPTLGGQTALNTAVALHEAGVLDKYGVELIGANI
DAIQAGEDRDSFKRVVERVGGESARSVICHSIEECLAAAEELNYPVVVRPSFTLGGAGSG
FAHNEEELRRIAGQGLALSPTTEVLLEESILGWKEYELELMRDANDNVIVVCSIENLDPM
GVHTGDSITVAPAMTLTDREYQRLRDLGIAIIREVGVDTGGCNIQFAVHPETGRTIVIEM
NPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEITNDITAKTLASFEPTLDYVVVKVPR
FAFEKFPGADSGLTTTMKSVGEVMAIGRSFPEALQKAMRSLEKKGSSFTWTGDPGDKEEL
LRAVRTPSEHRLRQVQQALRAGATVAELHEATKIDPWFLDQILRLDEKARELAAAPRLDA
DLLRSAKQLGFSDAQIGEITGRSEEVVRELRDALDVHPVYLAVDTCAAEFPATTPYLYSS
YDEETEVPPSSKPKVIILGSGPNRIGQGVEFDYSCVHASFALSEAGYETVMVNCNPETVS
TDYDTSDRLYFEPLTLEDVLEVVRAEQQTGEVVGVIVQLGGQTPLGLAKKLKEAGVPIVG
TSPEAIDLAEDRGEFGRVLAKAGLPAPKHGTAQSFDEARAIAEEIGYPVLVRPSYVLGGR
GMEIVYNEAMLADYIERNAEVSAEHPVLVDRFLDEAIEIDVDALYDGTELYLGGVMEHIE
EAGIHSGDSACALPAITLGQEDIERIRYSTEAIAAGVGVRGLINVQYALSAGELYVLEAN
PRASRTVPFVSKATAVPLAKAAARIMLGATIQELRDEGLLPRHGDGGTLPPDAPVAVKEA
VLPFNRFIDRHGQGVDTVLGPEMRSTGEVMGLDVDFGTAFAKSQLATYGTFPTSGTVFVS
VANRDKRTMIFPVRRLADLGFEILATEGTALALRRHGVQARVVRKHSEGPGPDGEPTIVQ
RIHNGEVDLIVNTPFGGPGQSGPRLDGYEIRTAAVARGVPSVTTVQGLAAAVQAIESLVN
GRIQVRSLQEHAQRLRDASQATA
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccgtactgatctttcgtctgtgctcgtgatcggctccgggccgatcgtcatc
ggccaggcgtgcgaattcgactactcgggcactcaggcgtgccgggtgctcaaagccgaa
gggctgcgggtgatcctggtcaactccaacccggccacgatcatgaccgaccccgaattc
gcggacgccacctacgtggaacccatcaccccggagatggtcgagaagatcatcgccaag
gagcgtcccgatgcgctgctgcccaccctgggcggccagaccgcgctcaacaccgcggtg
gcgctgcacgaggccggggtgctcgacaagtacggggtcgaactgatcggcgccaacatc
gacgccatccaggccggggaagaccgcgacagcttcaaacgcgtcgtggagcgggtcggt
ggcgagtcggcccgctcggtgatctgccactccatcgaagagtgcctggccgccgccgaa
gaactgaactatccggtcgtggtccgcccctccttcaccctgggcggcgccggctccggg
ttcgcccacaacgaggaggagctgcgccgcatcgcggggcaagggctcgcgctctccccg
accaccgaggtgctccttgaggagtccatcctcggctggaaggaatacgagctggagctg
atgcgcgacgccaacgacaacgtgatcgtcgtctgctccatcgagaacctcgaccccatg
ggcgtgcacaccggcgactccatcacggtcgcccccgcgatgacgctcaccgaccgcgaa
taccagcggctgcgcgacctggggatcgccatcatccgcgaagtcggggtcgacaccggc
ggctgcaacatccagttcgcggtccaccccgagaccgggcggaccatcgtcatcgagatg
aacccgcgcgtctcccggtcctcggcgctggcgtccaaagccaccgggttccccatcgcg
aagatcgcggccaagctcgccgtcggctacaccctcgacgagatcaccaacgacatcacc
gccaagacgctggccagcttcgagccgaccctggactacgtcgtcgtcaaagtgccgcgg
ttcgcgttcgagaagttccccggcgccgactccggcctgaccaccaccatgaagtcggtc
ggcgaagtcatggcgatcggccggtccttccccgaagcgctgcagaaggccatgcggtcg
ctggagaagaaaggcagctccttcacctggacaggagaccccggggacaaagaggagctg
ctgcgggcggtccggacccccagcgaacaccggctgcgccaagtccagcaggccctgcgg
gccggggccacggtcgcggaactccacgaggccaccaagatcgacccgtggttcctcgac
cagatcctccggttggacgagaaggcccgcgaactcgccgccgcgccccgcctcgacgcg
gacctgctgcgctccgccaaacagctcggcttctccgacgcgcagatcggcgagatcacc
ggccgctccgaagaagtcgtgcgggagctgcgcgacgccctcgacgtgcacccggtctac
ctggccgtggacacctgcgccgccgagttccccgcgaccacgccctacctgtactccagc
tacgacgaggagaccgaggtcccgcccagcagcaagcccaaggtcatcatcctcggctcc
ggacccaaccggatcggccagggcgtggagttcgactacagctgcgtccacgcgtccttc
gccctgtcggaggccggctacgagaccgtcatggtcaactgcaaccctgagacggtctcc
accgactacgacaccagcgaccggctgtacttcgagccgctgaccctggaagacgtgctc
gaagtggtgcgcgccgaacagcagaccggcgaagtcgtcggcgtgatcgtgcaactgggc
ggccagaccccgctcggcctggccaagaagctcaaagaagccggggtgccgatcgtgggc
accagccccgaggcgatcgacctggccgaagaccgcggcgagttcggccgggtcctggcc
aaagccgggctgcccgcccccaagcacggcaccgcccagtccttcgacgaagcccgggcc
atcgccgaagagatcggctacccggtgctggttcgcccctcctacgtgctcggcggccgc
ggcatggagatcgtctacaacgaggccatgctcgccgactacatcgagcgcaacgcggaa
gtcagtgccgaacacccggtgctggtggaccgcttcctcgacgaagccatcgagatcgac
gtggacgccctctacgacggcaccgaactgtacctgggcggtgtcatggagcacatcgag
gaggcgggcatccactccggcgactccgcctgcgctctgcccgcgatcaccctgggccag
gaggacattgaacgcatccgctactccacggaggccatcgccgccggggtgggggtgcgc
ggcctgatcaacgtgcagtacgcgctctccgccggcgaactctacgtgctcgaagccaac
ccgcgggcgtcgcgcaccgtgccgttcgtgtccaaggccaccgcggtccccctggccaag
gctgcagcccggatcatgctgggggcgaccatccaggagctgcgcgacgagggcctgctg
ccgcggcacggcgacggcggcactctgcccccggacgcaccggtcgccgtcaaggaagcg
gtcctgccgttcaaccgcttcattgaccgccacggccagggcgtggacaccgtcctgggc
ccggagatgcgctccaccggtgaagtcatgggcttggacgtggacttcggcaccgcgttc
gccaagtcccaactggccacctacggcacgttccccacgtcgggaaccgtgttcgtctcc
gtggccaaccgcgacaagcgcaccatgatcttcccggtccggcggctggccgacctcggg
ttcgagatcctggccacggaaggcaccgcgctggcgctgcgccgccacggggtgcaggcc
cgcgtggtgcgcaagcacagcgaagggcctggaccggacggggagccgaccattgtgcag
cgcatccacaacggtgaagtggatctcatcgtcaacacgccgttcggcggccccggccag
tccggaccgcgcctggacggctacgagatccgcaccgccgcagtggcgcgcggcgtgccc
agcgtgaccacggtccaaggcctggccgccgccgtgcaagccatcgagtcgctggtcaac
ggcaggatccaggtgcgttcgctccaggagcacgcccagcggctgcgcgacgcatcgcag
gcgaccgcgtag

DBGET integrated database retrieval system