KEGG   Thermobifida fusca: Tfu_1164Help
Entry
Tfu_1164          CDS       T00265                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tfu  Thermobifida fusca
Pathway
tfu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01130  Biosynthesis of antibiotics
tfu01230  Biosynthesis of amino acids
Module
tfu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tfu_1164
Enzymes [BR:tfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tfu_1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAZ55202
UniProt: Q47QR5
Position
1354914..1355720
Genome map
AA seq 268 aa AA seqDB search
MSVLDEIIDGVRADLAERQAAVPLDKLKEQAAALPWPKDVVAALRAPGVQVIAEVKRSSP
SKGALAAIADPAALARDYAAGGACMISVLTEQRRFAGSLADLAAVRAAVDTPLLRKDFVV
SSYQLWEARVYGADAVLLIVAALSQDALVSLVERAESLGLTPLVEVHTEEEVERALDAGA
TVIGVNARDLKTLKVDRGTFARLAPLIPDDKIKIAESGVRGPHDLLAYASAGADAVLVGE
SLVIGRKPREAVADLVTAGAHPALRDRH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgctcgacgagatcatcgacggagtgcgcgcggacctcgcggaacgccaggcc
gccgtgcccttggataagctcaaagagcaggccgcggccctaccgtggcccaaggacgtg
gtggcggcgctacgcgctcccggagtccaggtcatcgccgaggtgaagcgctccagccct
tccaagggcgctctcgccgcgatcgctgaccccgccgcgctggcacgcgactacgccgcg
ggcggcgcctgcatgatcagcgtcctgaccgagcagcgccgttttgccggcagcctggcc
gacctggcggcggtccgcgccgctgtggacacgccgctgctgcgcaaggacttcgtggtc
agctcctaccagttgtgggaggcgcgggtctacggtgcggacgcggtcctcctcatcgtg
gctgcgctgtcccaggacgccctggtctccctggtggagcgggccgaatccctcgggttg
actccgctcgtcgaagtgcacaccgaagaagaggtcgaacgtgccttggacgccggagcc
acggtgatcggtgtcaacgcccgggacctgaagaccttgaaggtcgaccgcggcactttt
gcccggttggctccgctgatccccgacgacaagatcaagatcgccgagtcgggggtgcgc
ggaccccacgacctgctcgcctacgcgagcgcgggagccgacgccgtcctggtgggggag
agcctggtcatcggacgcaaaccccgcgaggccgttgccgacctggtcacggcaggtgcc
caccccgcgctgcgggaccggcactga

DBGET integrated database retrieval system