KEGG   Thermobifida fusca: Tfu_1234
Entry
Tfu_1234          CDS       T00265                                 

Definition
(GenBank) putative hydrolase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
tfu  Thermobifida fusca
Pathway
tfu01057  Biosynthesis of type II polyketide products
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    Tfu_1234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:tfu01008]
    Tfu_1234
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     Tfu_1234
Polyketide biosynthesis proteins [BR:tfu01008]
 Polyketide tailoring proteins
  Oxygenase
   Tfu_1234
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M
Other DBs
NCBI-ProteinID: AAZ55272
UniProt: Q47QJ7
Position
1437548..1438660
AA seq 370 aa
MPSAADRRPPIEQLTALASATAAQTDLDRRVPPETIDLLTDAGFFRWSVPADYGGAAGSF
TDLARHVVHLSRHCPSTGWLASLFGHSGRYVACLPEEGRKEVWGSSPDVRIVSVVKPLGR
ATRVAGGWRLSGRWTYASGVEYSDWALLAGPAQGPGSDGGPPRFFAVPRSDYTYEDTWHT
LGMRGTGSHDIVIDDAFVPDHRTCLREDAMQGRTAEGDRRYAPTRAVNGLTFVTPALGAA
LGALDAALPLLKGPAAGPRAASHQAYQIAYARAAGQIDAARLLLDRVAETADAGRFTPEL
VQRSRRDSALALEMLTSAVDALARTGGTRGQADSHPLQRYWRDVRSVSGHAVMQFEQAGL
AYTQSLLAAG
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgccctctgccgcagaccgacgccccccaatcgaacagctcaccgccctcgcttccgct
accgcagcccaaactgacctggatcgacgcgtaccccccgagaccatcgacctcctcacc
gacgccggcttcttccgctggtcagtgccggccgactacggcggagccgcaggttccttc
accgacctggcccgccacgtggtccacctgtcccggcactgcccctccaccgggtggctc
gcctcgctcttcgggcactccggccgctacgtcgcctgcctgcctgaagaaggccggaaa
gaagtgtggggcagcagccccgacgtccggatcgtcagcgtcgtcaaaccgctcggccgc
gccacccgcgtagcgggcggctggcgcctgagcggccggtggacctacgccagcggggtg
gagtactccgactgggccctcctcgccgggcccgcgcaaggacccggatccgatggcggc
ccaccgcgcttcttcgctgtcccgcgcagcgactacacctacgaggacacgtggcacacc
ctgggcatgcgcgggacgggaagccacgacatcgtcatcgacgacgccttcgtccccgac
caccgcacctgtcttcgcgaagacgccatgcaagggcgcaccgcggaaggggaccgccgc
tacgcacccacccgggccgtcaacggcctcaccttcgtcacccccgcgctgggggctgcg
ctcggcgcactcgacgcggccctgcccctgctcaaaggccccgcagccggcccccgggca
gcctcacaccaggcgtaccagatcgcctacgcccgcgccgcgggacagatcgacgcggca
cgtctccttctggaccgggtcgccgaaaccgcagacgcaggccggttcacccccgaactc
gtgcagcggagcaggcgagactccgccctcgccctggaaatgctgacctctgccgtcgac
gcgctcgcccgcaccggcggtacccgcggacaggccgacagccaccccttgcagaggtac
tggcgcgacgtccggtccgtgtccggacacgcggtcatgcagttcgaacaggccggtctc
gcctacacgcagagccttcttgccgcaggctga

DBGET integrated database retrieval system