KEGG   Thermobifida fusca: Tfu_2015Help
Entry
Tfu_2015          CDS       T00265                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tfu  Thermobifida fusca
Pathway
tfu00010  Glycolysis / Gluconeogenesis
tfu00051  Fructose and mannose metabolism
tfu00562  Inositol phosphate metabolism
tfu01100  Metabolic pathways
tfu01110  Biosynthesis of secondary metabolites
tfu01120  Microbial metabolism in diverse environments
tfu01130  Biosynthesis of antibiotics
tfu01200  Carbon metabolism
tfu01230  Biosynthesis of amino acids
Module
tfu_M00002  Glycolysis, core module involving three-carbon compounds
tfu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tfu_2015
   00051 Fructose and mannose metabolism
    Tfu_2015
   00562 Inositol phosphate metabolism
    Tfu_2015
Enzymes [BR:tfu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tfu_2015
Exosome [BR:tfu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tfu_2015
  Exosomal proteins of bladder cancer cells
   Tfu_2015
  Exosomal proteins of melanoma cells
   Tfu_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAZ56048
UniProt: Q47NC1
Position
complement(2354873..2355658)
Genome map
AA seq 261 aa AA seqDB search
MATAKRKPLIAGNWKLNNNHLEAIALVQKMAFALNDADYDAADIAVLPPFTAIRSVQTLV
EGDKLRITYGAQDISQHEKGAYTGEVSGPMLAKLNCTYALAGHSERREYHHEDDAVVNAK
VKAAFASGITPILCLGEGLEVRKAGRHVEHTLAQLEGALKGVTEEQVRTLVVAYEPVWAI
GTGEVATPEDAQEVCAALRKRIGELYSPEAAQQTRILYGGSVKSGNVAAIMAQADVDGAL
VGGASLDADEFVKLIRAAVQG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgccaagcgcaagccgctgattgcgggtaactggaagctgaacaacaaccac
ctcgaggccatcgcgctggtgcagaagatggccttcgccctcaacgacgccgactacgac
gccgcagacatcgcggttctgccgccgttcaccgcgatccgcagcgtgcagaccctggtg
gaaggggacaaactgcggatcacctacggtgcccaggacatctcccagcacgagaagggc
gcctacaccggtgaagtgtccggcccgatgctggccaaactcaactgcacgtacgcgctg
gccgggcactcggagcggcgcgaataccaccacgaggacgacgcggtcgtcaacgcgaaa
gtcaaagcggccttcgccagcggcatcacgcccatcctgtgcctgggtgaagggttggag
gtccgcaaggcgggacgccacgtcgagcacaccctcgcccagttggaaggcgcgctcaag
ggcgtgaccgaggagcaagtccgcaccctggtcgtggcctacgagccggtgtgggcgatc
ggtaccggcgaagtcgccacgcccgaggacgcccaggaggtgtgcgcggcgctgcgcaag
cggattggtgaactgtactcccctgaggccgcacagcagacccgcatcctctacggcggg
tcggtgaagagcggcaacgtcgcagcgatcatggcgcaagcagacgttgacggcgcgctg
gtcggcggtgcgagcctggacgctgacgagttcgtcaagctgatccgcgccgcggtccag
ggctga

DBGET integrated database retrieval system