KEGG   Thermobifida fusca: Tfu_2641Help
Entry
Tfu_2641          CDS       T00265                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
tfu  Thermobifida fusca
Pathway
tfu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tfu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Tfu_2641
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tfu03011]
    Tfu_2641
Ribosome [BR:tfu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Tfu_2641
  Bacteria
    Tfu_2641
  Archaea
    Tfu_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AAZ56674
UniProt: Q47LJ8
Position
complement(3105350..3105727)
Genome map
AA seq 125 aa AA seqDB search
MGTRAQARFVRVTPRKARRVVDLIRGLPAEEAQAVLRFAPQAASGPVGKVLASAIANAEH
NDKLDRETLVVSRAWVDEGPTLKRIRPRGFGRAFRVNKRTSHITVEVAPRDTVGAASAKR
KERTR
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgagggcacaagcgcggtttgtccgcgtcacgccccgaaaggcccgccgggtg
gtggaccttattcgcgggctgcccgctgaggaggctcaggcggtgctccggttcgcacct
caggcggcaagtggaccggtggggaaggtgctcgccagcgccatcgccaatgccgagcac
aacgacaagttggaccgtgaaacgctggtcgtcagtcgcgcctgggtggacgaaggaccg
actctgaagcgcattcggccgcgaggcttcggccgtgcgttccgagtcaacaagcggacg
agccacatcactgtggaagtcgcgccgcgtgacaccgtgggcgccgcgtcggccaagagg
aaggaaaggacccgatag

DBGET integrated database retrieval system