KEGG   Thermococcus gammatolerans: TGAM_1288Help
Entry
TGAM_1288         CDS       T00920                                 

Gene name
acdB-2
Definition
(GenBank) Acetyl-CoA synthetase (ADP forming), beta chain (acdB)
  KO
K22224  acetate---CoA ligase (ADP-forming) subunit beta [EC:6.2.1.13]
Organism
tga  Thermococcus gammatolerans
Pathway
tga00010  Glycolysis / Gluconeogenesis
tga00620  Pyruvate metabolism
tga00640  Propanoate metabolism
tga01100  Metabolic pathways
tga01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TGAM_1288 (acdB-2)
   00620 Pyruvate metabolism
    TGAM_1288 (acdB-2)
   00640 Propanoate metabolism
    TGAM_1288 (acdB-2)
Enzymes [BR:tga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     TGAM_1288 (acdB-2)
Lipid biosynthesis proteins [BR:tga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TGAM_1288 (acdB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 ATP-grasp_2 ATP-grasp GARS_A CPSase_L_D2 DUF5126 Fer4_NifH
Motif
Other DBs
NCBI-ProteinID: ACS33790
UniProt: C5A6C8
Position
1210434..1211132
Genome map
AA seq 232 aa AA seqDB search
MSRVEEARKIIEKAKAENRPLVEPEAKEILRLYGVPVPDFKVATNEEEAVKFAREIGYPV
VMKIVSPQIIHKSDAGGVKVNIKNDEEAREAFRTIMENARKYKPDADLWGVIIYKMLPLG
KEVIVGMIRDPQFGPAIMFGLGGIFVEILKDVSFRVAPITKEEALEMIKEIKAYPILAGA
RGEKPVDIEALADIIVKVGELALELPEIKELDINPIFAYEDSAVAVDARMLL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgtcgaagaggcaaggaagataatcgagaaggccaaggccgagaacaggccg
ctcgtcgagcccgaggcgaaggagatactccgcctttacggcgtcccggttccggacttc
aaggtcgcgaccaacgaggaggaggccgttaagttcgcccgtgaaatcgggtatccggtg
gttatgaaaatcgtttctccgcagattatccacaagagcgacgccggtggtgttaaggtc
aacatcaagaacgacgaggaagcgagggaagccttcagaacaatcatggagaacgccagg
aagtacaagcccgacgccgacctctggggcgtcataatctacaagatgctcccgctcggc
aaggaagttatagtcggtatgatacgcgacccgcagttcggtccagctataatgttcggt
ctcggtggaatcttcgtcgagattctcaaggatgtttccttccgcgtcgccccgattacc
aaggaggaagcccttgagatgattaaggaaatcaaggcctacccgattctcgccggagcg
cgcggtgagaagccggtggacattgaggcccttgcagacatcatcgtcaaggtcggcgag
ctcgcccttgagcttccagagattaaggagctcgacatcaacccgatttttgcctatgag
gactcagctgttgccgtcgacgcgaggatgctcctctga

DBGET integrated database retrieval system