KEGG   Thermococcus gorgonarius: A3K92_08895Help
Entry
A3K92_08895       CDS       T05047                                 

Definition
(GenBank) hypothetical protein
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
tgg  Thermococcus gorgonarius
Brite
KEGG Orthology (KO) [BR:tgg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tgg03016]
    A3K92_08895
Enzymes [BR:tgg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     A3K92_08895
Transfer RNA biogenesis [BR:tgg03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    A3K92_08895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYW3
Motif
Other DBs
NCBI-ProteinID: ASJ01589
UniProt: A0A2Z2M8C3
Position
complement(1589893..1590480)
Genome map
AA seq 195 aa AA seqDB search
MFLYTKNFEEQKERAMEGLRKALAEDKVDYDIIPLLEKINALDNYFTTSSCSGRISVMEM
PHFGDKVNSVWLGKWHREVTVEEVLEAIGKHRSGQLWFLVRSPIIHVAAKTLEDAVKLLN
LAVGLGFKYSNIKSVSHKKLLVEIRSTERMDVPLGENEELWVSEEYIGKIVNLANAQVRR
FKGKLKRLEEEIEKL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgttcctctacaccaagaacttcgaggagcagaaagaaagggctatggaaggcctcagg
aaagctctggccgaggacaaggtagattacgatataatccccctccttgagaagatcaac
gccctcgataactacttcactacaagctcatgctccggtaggatttcggtcatggagatg
ccccacttcggcgacaaggtgaactcggtctggctcggcaagtggcacagggaagtaacg
gttgaggaagttcttgaagccatcggaaagcaccgctccggccagctgtggtttctagtg
aggagtccgatcatccacgtcgcggctaaaaccctggaagacgccgtgaagctgctcaac
ctcgcggtaggcctcggcttcaagtacagcaacatcaagagcgtcagccacaagaagctc
ctcgtcgagatacgctctaccgagaggatggacgtccctttgggagagaacgaggaactg
tgggtgagcgaggagtacatcggaaagatcgtgaacctcgccaacgcacaggtgaggcgc
ttcaagggaaagctgaagaggctggaggaggaaatagaaaagctctga

DBGET integrated database retrieval system