KEGG   Thermococcus gorgonarius: A3K92_09160Help
Entry
A3K92_09160       CDS       T05047                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tgg  Thermococcus gorgonarius
Brite
KEGG Orthology (KO) [BR:tgg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A3K92_09160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Ytca
Motif
Other DBs
NCBI-ProteinID: ASJ01636
UniProt: A0A2Z2M7F5
Position
1641845..1643056
Genome map
AA seq 403 aa AA seqDB search
MDPWLLITIVLGFAMAWAIGANDAANSMSTAVGAKAITPKQAVIIAGILEFTGAYFFGKS
VTETIRKGILDPTMITDPNVLIYGSAAALLAATIWLVIATKFGLPVSTTHSIIGGIVGYG
IVYAGTAIVNWGKMGQVVLSWILSPIIGALMAFLIFKAMTRSIFETKDPVRNARIWSPFW
IGLAFVVIGTMFYIKVLHGGDLKAGVMMYGLPAGVVTFIVTYLLIKLRFRSADPLINVES
IFKKAQLVTSSYVALAHGSNDVANAIGPVAAVYAVATMGLSGMQVPVPRWILAMGGLGIT
IGVATYGYKVMETVGKKITELTNTRGFTIQFSAATVVLVSSWLGLPISTTHVVVGAVIGV
GLARGVKAINKDIVRDIIISWFVTVPVAALISAAIFKILMLVG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggatccatggctgctgataacgatagtcctgggttttgccatggcttgggcaataggt
gccaacgatgccgcgaactcaatgagcaccgccgttggggcgaaggcgataacgccgaaa
caggccgtcatcatagcgggaatactggagttcacaggtgcctacttcttcgggaagagc
gttaccgagacaataaggaagggaatcctcgacccaactatgataaccgatccgaacgtt
ctcatctatggttctgctgcagcactcttggctgctacgatatggctggttatagcgacg
aagttcggacttccggtctcaacaacccattcaatcattgggggaatagtcggctacgga
atcgtctacgcgggaacagcgatagtcaactggggcaagatgggtcaggttgtcctgagc
tggatcctttcccccattatcggagcccttatggcattcctcatatttaaagctatgact
agaagcatttttgaaactaaagacccggttaggaatgcccgtatctggtctccgttctgg
ataggccttgcctttgtggtaatcggaacgatgttctacatcaaagtcctccacgggggc
gacctcaaggcgggcgtgatgatgtacggcctccccgcgggcgttgttactttcatcgtg
acatacctcttgataaagctccgcttcaggagtgcagaccccctcataaacgtcgagagc
atctttaagaaagcccagctcgtgacttcaagctacgttgccctggcacacggttccaac
gacgttgcgaatgcaatagggccggtagcggccgtctacgccgtcgccactatgggcctc
agcggaatgcaggtgccggttcccagatggatactggcgatgggcggtcttggaataacc
attggcgtggccacctacgggtacaaggttatggagaccgtcgggaagaagataaccgaa
ctgaccaacacgagggggttcacaatacagttctccgccgcgaccgtcgttctcgtctca
agctggctcggccttccaatatccacaactcacgtcgtcgttggggcggttataggcgtc
ggcctcgccaggggagtaaaggcaataaacaaggacatcgttagggatataataatctcc
tggttcgttaccgtcccggtcgccgctttgatcagcgcggccatattcaaaatcctgatg
ctcgtggggtga

DBGET integrated database retrieval system