KEGG   Toxoplasma gondii: TGME49_201190Help
Entry
TGME49_201190     CDS       T01093                                 

Definition
(RefSeq) hypothetical protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 7894305
NCBI-ProteinID: XP_002367445
UniProt: S8F9Q4
Position
VIIa:3981083..3981442
Genome map
AA seq 119 aa AA seqDB search
MHVRRVLRQGWRRGSGEGIVSVLVAFRNRDASGHFSSLPLSRVLCLVTSLAQNKLTRGTT
QKTLATTLSAHSLHDARNETNQSCTDNTEAPYAGADGTIANAETQAKEHKKLIIPLSAK
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttcgtcgtgtgttgcgtcaagggtggaggagggggagtggcgagggaatagtc
tccgtcttagtggcttttcggaaccgtgacgcatctggccacttttcttctttgccgctc
tcgcgggttctgtgtctggtcacatctctcgcacaaaacaaactgacacgtggtaccacc
cagaaaactctagcaacaacgctttctgcgcattcgctgcatgacgcgcgaaacgagacc
aatcaatcttgcacggataatactgaggcgccatacgctggggcagacggcacgatcgcc
aacgccgaaacacaagcgaaagagcacaaaaaactgatcatcccattatccgcaaagtaa

DBGET integrated database retrieval system