KEGG   Toxoplasma gondii: TGME49_201200Help
Entry
TGME49_201200     CDS       T01093                                 

Definition
(RefSeq) zinc finger (CCCH type) motif-containing protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YTH Torus zf-CCCH zf_CCCH_4
Motif
Other DBs
NCBI-GeneID: 7894149
NCBI-ProteinID: XP_002367446
UniProt: S8F6K2
Position
VIIa:join(3977201..3977748,3978372..3978711,3979284..3980090,3980362..3980589)
Genome map
AA seq 640 aa AA seqDB search
MSLPPVGPSGAASASFVPPVLPPSYPFSSFASPGLALSVQAHALLPLASSASAASAPRRR
RKRKILQDFLGSTSSRPASSRVSALSPSSASPAPASVTDQRFQFSFEPSLEQQKQEEGRL
LNEQGISRADCVSGRQWGKHTVVCRHWWKGMCMKGEFCDFLHQLIYHRMPACRNQLCCPD
TRRGCCPFRHEDGGPAGAPKAVPGAPAAGDGHGSVAGGQEGEEAANVYGASLPDFTSTDY
VSGGAGASGNQQECVNYFLGFCKHGPKCRRKHTAKNRRDIPPILPTWFLDQILANPQVFP
TELDAESEEQLAEVIGRCRQLSQASRGSVPAPPVSSHANLSSFSSVSSCGNLSRGGLEAS
RGVSRSESQAGAGKDGSAFRGPFPSSMAGAGASSACFSSGAFSTAGSQREGIGSLSSATL
LAPSTTCVVPLLVDPFGHVASPQSTKRFFIIKSNRMSNIYTSIQHGVWATSKGNSRKLSN
AFTSTDHVLLLFSANESGGFQGFGRMMSLPDPQLFPGIWGPVQLRLGSNFRVMWLKQCKI
EFEELGKVTNPWNDDLPLRKSRDGTEVPPALGSLLCTWMSQRPSEDLLAGTGIDPATRID
HSAFFAMLLQNKLLSVPPSGTVEGTLQPTAPIDLRHCEPS
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcccccccgtcggtcccagcggggccgcgtctgcttcctttgttccaccagtt
cttcctccgagctatccattcagctccttcgcttcgcctggcctcgccctctctgtgcag
gcgcacgcgcttctgccgctcgcctcttcagcttccgccgcgtcggcgccccgaagacga
aggaagcggaaaatactgcaggactttctcggttccacgagttcgcggcctgcgtcttct
cgggtctctgcgctctctccgtcttctgcgtctccggcgcccgcctcggtcactgaccag
aggttccagttttctttcgagccttctctggagcagcaaaagcaagaggagggtcgcctg
ctgaacgagcagggcatctccagggccgactgcgtgagcggacgccagtggggaaaacac
acagttgtctgcagacactggtggaaaggcatgtgcatgaagggcgaattctgcgacttt
cttcaccaactgatctaccaccggatgcccgcatgccgcaatcaactgtgctgtccagac
accagacgaggctgctgtcccttccgccacgaagacggtggcccagccggtgcgcccaag
gccgttcccggcgcgccggcggccggcgacggccatggctctgtcgcgggagggcaggag
ggcgaggaggcggcgaacgtgtacggggcgtcgctgccagacttcacttccacggattat
gtgtctggaggcgcaggggcgagtggcaatcagcaagagtgtgtgaactactttctgggc
ttctgcaaacacggacccaagtgccgccgcaagcacacagcgaaaaaccgaagagacatc
ccgccgattctccccacatggttcctcgatcagattctggcgaatccgcaagtgtttccg
acggaactggacgccgagagtgaagagcagctggctgaggtgatcggtcgctgtcggcag
ctttctcaggcgtctcggggctctgtcccagcaccgccagtgtcttcgcacgcgaatctc
tcgtcgttttcatctgtttcttcgtgcgggaatctgtcgcgtggagggctggaggcctct
cgcggcgtgtcgaggagtgagagccaagctggcgccgggaaggatgggtcggcctttcgc
ggtccgtttccctcctcgatggcaggtgcaggggcttcttcggcttgcttctcctccggc
gcgttctccacggctgggtctcagagagagggcatcgggtctctctcttcggcgacgctt
ctcgcgccttcgacgacctgcgtggtgccgctcctcgttgatccgttcggccatgtcgcc
tcaccgcagagcaccaagcgcttcttcatcatcaagagcaaccggatgagcaacatctac
acgtcgatacagcacggcgtgtgggctacgagcaagggcaactcgcggaagctcagcaac
gccttcacctccacggaccatgtcctcctgctcttctccgcgaacgaaagcggaggcttc
cagggtttcggccgcatgatgagtctccccgatccccaactcttcccgggcatctggggc
cctgtacagctccgcctcggatccaacttccgggtcatgtggctcaaacagtgcaagatc
gagttcgaagaacttgggaaagtcaccaacccctggaatgacgacttgccgcttcgaaaa
agcagagatggaacggaagtgccaccggctttagggtctctcctctgcacatggatgtcc
cagagaccgtctgaggatttgctagcaggcactgggatcgatccagcaacccgcatcgac
cactcggccttcttcgcgatgctccttcagaacaagttactgtctgtccctccctcggga
accgttgagggcacactgcagccgacagcacccatcgacttgcgccactgtgaaccgtcg
tag

DBGET integrated database retrieval system