KEGG   Toxoplasma gondii: TGME49_201215Help
Entry
TGME49_201215     CDS       T01093                                 

Definition
(RefSeq) hypothetical protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 29768779
NCBI-ProteinID: XP_018637445
UniProt: S8GET5
Position
VIIa:complement(join(3969940..3970124,3970805..3971108))
Genome map
AA seq 162 aa AA seqDB search
MHVCHGGRQRGVEGPDAARGRQRRFLVLSERKEKAHLSVIHVLPAPAAHEGGLASAFQRS
FRAQRSSVVCYRVAFSSRGVSSMDGTQSSHPRSSIDRVTSCADSVASSSRPILANKLPRR
SFTPFPSLQRRLFMLLPLLCPPFRSSFCQTPPSSAFLRTSFL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgtgtcacggcggtcgccagcggggagtggagggacccgatgcagcgcgcgga
cgccagaggcggtttcttgtcttgtccgagaggaaagaaaaagcgcatctttctgtaata
cacgttttgccagctccggcggctcatgaagggggacttgcttctgcgtttcagcgttct
ttcagggcgcaaagaagctccgttgtgtgctaccgagtcgcattctcttcaagaggagtg
agctcgatggacggcacacagtctagccaccctcggagctcgatcgacagagtcacgtct
tgcgctgactcagtcgcatcttcctcgcgacccattttggcaaacaagctccctcgtcgc
tctttcacgccctttccttctcttcagaggagacttttcatgcttctccctctcctttgt
ccacccttccgctcttctttctgtcaaactcctccctcttcagcttttcttcggacctcc
tttctctga

DBGET integrated database retrieval system