KEGG   Toxoplasma gondii: TGME49_201220Help
Entry
TGME49_201220     CDS       T01093                                 

Definition
(RefSeq) zinc finger protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-B_box DUF885
Motif
Other DBs
NCBI-GeneID: 7894183
NCBI-ProteinID: XP_002367448
UniProt: A0A125YV87
Position
VIIa:complement(join(3961047..3961238,3961789..3961864,3962469..3962608,3963315..3963390,3963913..3964051,3964296..3964452,3964685..3964763,3965568..3965692,3966278..3966597,3967261..3967380,3968124..3968191,3968851..3968978,3969451..3969642))
Genome map
AA seq 603 aa AA seqDB search
MATSVGGDVRLSEKDLGAVLRDSDEWAFLEYLLQMSVRTSRVRLLQAWHIATPHLVSAFE
RRTQGRLLTYSFVDTASLDEDNSLQDIARRGLKIPMTGMRFAVGNFSLPGFPLMRGGPAE
AEDPFVLPSSAVSTRQEEAKKDRSKFLDAARSQLLTGERRIFEYLLCQVGVGRSVVVEDE
KEACGSRFSLLWEYDSAYLEKGALAPEESLTVHYQAVDDSKSGDDGPLKKTKDQEEARNS
RPASLPSIFGDGKKVTPGVLPQYTFRHDYVVYDSSQVLPRFFLLFEMDPSLEELFAVPLC
DNCQDNPACIWCPADAARLCASCDELIHQQNRLVSRHIRVPLNEMPRAFGTCRRHPGEVY
ELFCSICHVAVCRLCRGNHLHAAPSKALGDEGSLSIVAGGRSLMPLNKPYQAVLHMAKKP
HFVLAARRTELEKRLEEVQKMLDGVRRNCREEEQRCYAILEEAITQLHSCTEDKMGAVLS
RQLELQREIDTMDWSESFLQYLRTVLPPADFLHAWLRHCRLRDELDALAGDPSMLSRNVF
PDMRLQGRVDILTDSALRRRDYVAVEGRRAPMATAGSDKKGPDEQRRKSPEKRVHFGSTL
LAG
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctctgtgggcggcgacgtccgcctgtctgagaaggacctcggagctgtttta
cgagactctgatgaatgggcctttctcgagtacctcctgcaaatgagtgtgaggacgtct
cgcgtgcggctgcttcaagcttggcacattgcaacgcctcacctcgtcagcgccttcgaa
agaagaactcagggccgcttgctgacgtactccttcgtcgacaccgcctcgcttgacgaa
gacaactccctccaggatatcgcgcgaaggggcctgaagatcccgatgacgggcatgcgc
ttcgctgtcggaaacttcagtctccctggcttccctcttatgcgtggaggccctgccgaa
gctgaggatcccttcgttctcccgtctagtgctgtatcaacgcgtcaggaggaagccaaa
aaggacagaagcaaattccttgacgccgcccgttcacagctgctgacgggcgaacggcga
atcttcgagtatcttctgtgtcaagtcggtgtgggccgctctgtcgttgtcgaggacgag
aaggaagcgtgtggaagtcgcttctcacttctctgggaatatgattcggcttatctggag
aaaggtgcactggcccccgaggaaagtctcactgtgcactaccaagctgtcgacgactcg
aagtccggagacgacggcccgctgaagaagacgaaagatcaggaggaggcgaggaactcg
cgccccgcgtctcttccctcgatcttcggcgacggcaaaaaggtgacgcccggtgtgctg
cctcagtacaccttccgccacgattacgtcgtctacgactcctcacaggtccttcccagg
ttctttcttctctttgaaatggatccctcgctggaggagctgttcgccgtgcctctctgc
gataactgccaagacaatcctgcatgcatctggtgcccagcagatgctgcacgcctctgt
gcgtcgtgtgacgaactcatccaccagcagaaccgacttgtctcccggcacattcgagtg
ccgctgaacgagatgccgcgggcgtttgggacatgcagacgccaccctggggaagtgtac
gaactgttttgctccatttgccacgttgccgtctgccgcctctgtcgcggaaaccatctt
cacgctgctccgagcaaagctctcggcgatgaagggtctctctcgatcgttgcaggaggc
aggtccctgatgcctctgaataagccgtaccaggccgttctgcacatggcgaagaagccg
cactttgttttggccgcaagacgaactgagttggagaagcgtctcgaggaagtgcagaag
atgctcgacggggtccgccgaaattgtcgcgaggaggagcagagatgttacgctattctt
gaagaagccatcacgcaacttcacagctgcacggaggacaagatgggggcggttctctcg
agacagctcgagcttcagagggaaatcgacacgatggactggagcgaatctttcctccag
tacctgcgcaccgttctgcctcctgccgacttcctccacgcctggttgcgacactgccgt
ctgcgcgacgagttggacgccctggccggggacccctccatgctgtcgcgcaacgtcttt
ccggacatgcggctgcaaggccgcgtggatatcctgaccgattcggcgctacgccgccgg
gactacgtggcggtggaaggtcggagagcccccatggcgactgcagggagcgacaaaaaa
ggcccggatgaacagaggcggaagagtccggaaaagagagtccacttcggctccacactt
ctcgcaggctag

DBGET integrated database retrieval system