KEGG   Toxoplasma gondii: TGME49_201230Help
Entry
TGME49_201230     CDS       T01093                                 

Definition
(RefSeq) kinesin motor domain-containing protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 7894387
NCBI-ProteinID: XP_018637444
UniProt: S8F9P8
Position
VIIa:join(3952191..3953447,3953955..3954161,3954756..3954923,3955364..3955453,3955969..3956289,3956677..3957290,3957729..3958150,3958494..3958919,3959199..3959443)
Genome map
AA seq 1249 aa AA seqDB search
MWTSTHAVSPTPRQRCHPSLSLSSAPSMSSQKGGFVRHRPNAEEECLLPSRRSRLRHSSC
HSRVAPRPRARASSREASFPPLGAPYGESFFEGRGDKSSAMPPIWTTFSSPPSQVQASAG
GLLSQKENVETAILEVISQAAGKAVQQALADHYSASKKRLQGDEDEEPVTEAMVRIMPGN
IGLRAETEGEDGEAENRLLSLPPLTCRFAIDKDVNDPEGRPKIRHVSTEVASEADECNPA
CQRESSASTMCTKTSAPSFENLSSFSSPAQTARQGHPTPGIYGPAYLVPSLYPQFAACLS
PRSSAFPAGLSNFSGFSSERFRSFSGAADLLERHCVTARQRRESLRGPRSSAPADDETGI
DTILAQGSLSTTRGKDGEAVQGESGSRRNSVDPSTAERLELRKLLKGVVKLWSTKKKYEN
MVNRLKEWARDRYLATGELPDRTQLATDRPGLRSQCCQLKASVKQQAANLREQMKSLLPA
DANIFAAPQKNEDVAPKKPAASYPRQPKTGDKGGSASLLIGEKLERIEHLLTTVERVLPP
QAWKDADDSSRSKWLDEQVQVEDSAAIRRLVGTFRQIKAVQSQVSTLLQKQGKCLSPNEL
LHGNGRSSAGSASGRKEPNATEACEDKKTEHSEGGQETSIEKEQGAERQASEEGQEAQGT
AGSSSAGHTTAAVATIPLLKKKLREVTAERDALENRFASVLRLHEKQQRLLVDLAKENEK
HLTELLTVRGTHRIFGCVYTPGRDPSGANSWELWGEEDDEESSESGGRGDPAARFAAFEQ
VEAQAAEELEVRGLGPVDGSGRVSSPDKETEMHLSLVKAFLARRTNSLSTLFFGGSKALP
EPGSRRKGKNSAFEFDRVYPADTRVRHLFHGFSDLLQSCVGDGLNFCLVAVGPRTPEKTA
LLLGRPPSFSSAVGPYCEAKDVGLAQLLSRFVFDELEKVCVKWASEREEETRSRTGRSSI
VMSPAPSLKTNEGRRRQRETKSDGHCLPQFSVSVSCLEISRERMKDNFVGDKRLAKKLDI
RRDTRTGEVKILNLTTRATPTCNSLLQAISEASSSIPSSVLGGDAEIHSSSLLFIHTEVV
NPATREVKRGKIALVDMPSSFSLSLPPELKPAFDAAGRRDEATALRRLISSLSSPSPSTA
LSLSGREADGEVDLSLNMTFGAIKEIFLAARRTPSTLCPTCRPYASSTESEGARERSKST
ASERADSVKGLYHSTCVTQVLEDCLNPSLSRALLLFCLPSHGSSTTDEE
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atgtggaccagcacacacgctgtgtcgccgacgccacgtcagcgctgtcacccctcgctg
tctctgtcgtctgccccgtcgatgtccagtcagaagggcggctttgttcggcatcgacct
aacgcagaagaagagtgtctgcttccctcgcggcgatcacgactccgtcactcaagctgt
cactctcgcgtcgctcctaggccccgagctcgggcaagctctcgagaagcttcctttcct
cccttgggtgcgccgtacggagaaagcttttttgaaggtagaggagacaaaagctctgcg
atgccgcccatctggacgacgttctcttcgccaccgtcacaggttcaggcgtcagccggc
ggtctgctatcgcagaaggaaaatgttgagaccgcaatcctcgaggtcattagccaggcg
gcgggaaaggccgtgcagcaggctctggcggaccactactcggcctcgaagaaacggcta
caaggtgacgaggacgaggaacccgtcacggaggcgatggtcagaatcatgccagggaac
atcgggctccgcgcggagacggagggggaagacggagaggcggaaaaccgtctcttgtct
cttcctcctttgacctgccggttcgccatcgacaaagatgtaaacgatcctgaggggcga
cccaaaatccgacatgtgtcgacggaagtggcttctgaagcagatgaatgcaatcccgcg
tgtcagcgggaaagcagcgcctcgactatgtgtacaaaaacttccgctccgtcattcgag
aatctatcttccttctcgagccccgcccagactgccagacaggggcatccaacgcccggg
atctacggtccagcttacctggttccctccctctatccccagttcgccgcttgcctgtct
cccaggtcttcagcctttcctgcgggactgtctaacttctcggggttctcgtctgagcgc
ttccgctctttcagtggggcagcagacttgctggagagacactgcgtgacggcgaggcag
aggagagagtcgttgcgaggtccgaggagtagcgcccctgctgatgacgagacaggaatc
gataccattctcgcacaggggtcgctttcaacgactcgagggaaagacggtgaagcagtt
caaggcgaaagcggaagtcgaaggaactccgtagacccgtccactgcggagaggctcgaa
ttgaggaaactgctcaaaggcgtcgtcaaactctggagtaccaagaaaaaatacgaaaac
atggtgaatcgcctcaaagagtgggctcgagatcggtacctggcgactggcgagctgcca
gaccgcactcagctggccacagacaggcccggattgcggtctcagtgttgtcaattgaag
gcctcggtgaagcaacaggctgcgaatctccgagagcaaatgaaaagtcttttgcctgcc
gacgcaaacattttcgctgccccgcagaagaacgaagacgttgcgcccaagaagccggcg
gcaagttatccgcggcaaccgaagacgggtgacaaaggaggcagtgcttcccttctgatt
ggcgagaaactggagcgcatagagcacttgctgacgaccgtcgaacgcgttttaccgccg
caggcgtggaaggacgcggatgactcgagccgctccaagtggttagacgagcaagtccaa
gtggaggactccgccgcgattcggcgtctcgtcggcacctttagacaaattaaggcagtg
caaagtcaagtcagcactctcttgcagaagcaaggcaagtgtctgtctcccaacgagctt
ctccacggaaacggtcgctcttctgcgggaagcgcatcaggcagaaaggagccaaacgcg
acagaggcgtgtgaggacaaaaagacagagcacagtgaaggtgggcaggagacctcgatc
gaaaaggaacaaggtgccgagagacaagcatccgaagaggggcaggaagctcaaggcact
gcgggttcttcctctgccggacacacgactgccgctgtagccactattccgctcctcaaa
aagaaacttcgggaggtgacggcggaacgcgacgcgttggagaaccggttcgcttccgtt
ctgcgtctccacgagaagcagcagaggctgctggtcgatctagcaaaggagaatgagaag
cacctcaccgaacttctgacggtgcgcggtactcaccgcattttcggctgcgtgtacact
ccaggtcgcgacccgagcggcgccaacagctgggaactgtggggagaagaggacgacgag
gagagttctgagagtggcgggagaggagaccccgctgctcgcttcgctgcgtttgaacag
gtggaggctcaggctgctgaagagctcgaagtgcgaggactcgggccagtcgacggcagc
gggcgcgtttccagcccagacaaagagactgagatgcatctctctctcgtaaaggcgttc
cttgcccgtcgtacgaactctctctccactctcttttttggaggctcgaaagcacttcca
gagcctggatctcggcggaaggggaaaaacagtgcgtttgaattcgaccgcgtctaccca
gcagacacgcgcgtcagacacctcttccacggcttctccgatctccttcaaagttgtgta
ggcgacggcctcaatttctgtctcgtcgcggtcggccctcggactccagagaagacggcg
cttctccttggtcgaccgccctccttttcgtctgctgtagggccgtattgcgaggccaag
gatgttggtctggcgcagctgctttcgcgctttgtcttcgacgagctggagaaggtctgc
gtgaagtgggcgtcggagagggaagaagaaacaaggagcagaaccggcaggtcgtccatc
gtgatgtcgcctgcgccttctctgaagactaacgaagggaggagaagacagagagagacg
aagagcgatggacactgtctcccacagttctctgtctctgtgagctgcctggagatcagt
cgagagaggatgaaagataatttcgtcggagacaaacgactcgcgaagaaactcgacatt
cgaagagatacacgaacaggcgaagtcaagattctgaacctcacaactcgggccacacct
acgtgcaattctctccttcaagccatcagcgaggcgtcttcctccattccgtccagtgtt
ctcggcggagacgcagaaatccattcttcttctctcctcttcatccacactgaagtcgtg
aatccggcgacgagggaagtgaagaggggcaagattgccttggtagacatgccttcttcc
ttctcgttgtcgcttccgcccgagttgaagcctgcgttcgatgccgcgggaagacgagac
gaggcaacagctctaaggcgactcatttcttctctctcctccccgtctccttccacagca
ctctctctctccgggagagaagcggacggcgaggtggacctgtcgctgaacatgacgttc
ggagccatcaaagaaatctttctagccgcgagacgcactccttccaccctctgcccgacc
tgccgcccgtacgcttcctccacagagagcgaaggcgctcgcgagagaagcaaatctaca
gcgtcggaacgagcagattctgtgaagggcctttaccactcgacctgcgtaactcaggtg
ctggaagactgcttgaatccgtccctctctcgtgcgcttcttctcttttgtctgccgtct
cacgggtcgtcgaccaccgatgaagagtag

DBGET integrated database retrieval system