KEGG   Toxoplasma gondii: TGME49_201250Help
Entry
TGME49_201250     CDS       T01093                                 

Definition
(RefSeq) histone lysine methyltransferase, SET, putative
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHD
Motif
Other DBs
NCBI-GeneID: 7894012
NCBI-ProteinID: XP_002367451
UniProt: S8F3I6
Position
VIIa:join(3938631..3938969,3939602..3939754,3940200..3940447,3940768..3941000,3941176..3941283,3941613..3941854,3942120..3945704)
Genome map
AA seq 1635 aa AA seqDB search
MPAQAAARAGAMPPEDGHPRPPSRSAKVPSGDTKRESDIEAGAQSPLLVIPPPRIDLFPP
EPEAGKQVDWLPPHRYAEGLTPELRRNLEERGLRPCSLREVLERRNKMWAKVQMISPEAR
GEKERLDSLFKQQCVGWGNNQEGWVYGKWNPVILCPDFRQGGLQVSRSGRRQLWECLKSV
VEGFVDPRLQICEVVDPTHPVRFATPPQETCYTVVYVGPKIPASRKARVVFGEYTGVVKD
GGLVKKRFEYVFDLSFSALAWRRAEEFETASDSSDDDCPSLPSRDSRDEKLSESPVSSGS
VTSQSRQLSRLPGGKDRKKSVTVSGRRDAKGLTRVELPARSQFVLDSSEACNEMSLVNHY
GTIELLGDCVCKRNSEWQQVFVDGWPHIVLTSIPGVAVEPGDEILADFGNAWFFKVQDAS
HEAIARELLEYRVGIRTAPSQKLVPARPVECVNRRSDPQLENRARLGEICPYCLSHEHRP
CASSLAPSPSTESREPSKMSKSPEEAHGRGREGGAETGRCSSSSGWSAERKSSGEAATPA
EKPVSGLCEKLRNDGRGREKADEPRSLSSLSSGFPMCSASTPSQRQSGSRSSPSSSDLLL
VTQQLEREKHSSDQASVAAASPDLSLPPAPPPPTAVMTPQPKGNAEEKFVETNTEETGRL
APCSFSGDEVVHCDGCDRPCHLRCLPDPEAILNDWRWYCAVCRMRFFEMSRHLNYKILLS
SEALASLEKEGILASVGNREGHEVKWTAAQAGNMGVHALAKTPDGEAAADEVERKKERRP
SCGGIEHHSRRRESPEPVAGGRRRAERETEDENPGKAKKWRGSRVSKERSASTGSQRRTG
QHGDETEGQETEKEDQTKSEGSPTLLSGRQRSRGLREPRQEEKTRAGAELVGTQNSGVKT
ELSEMEVLSGDSRSSNIEAPVGVNTDGKGEACSGRRQLASVSDARMPTGSVSLGGEAQEK
ENKEPLTAVGMEFLNVPLEELGKGSGAMLWNEADEASLSPVAVSQLGCGPLRDGAGTNEG
NDVVLRPGSTEATGTEGTCSAESLPECSRSLVGKEQDVFSFFLGSRDTANTSASHTGPPR
SDARGKEEKDAKDVSPTGREAHEDCSQSDGPSRVSGAGPLAVVTTTAPSSESDEDGGKEV
RVGIRESSPSRGLDRSGAQPTSVDSVRPRARCHSSERRSDANRFDLPPVGIRERRAVFAS
CNEKASLGRMTPSRVEIVKGDLSSDELQGLQTLHLVDPKGLLGSLQPCDVCYKALGGRAS
TEVCRLAKRHLSPNWDHPHSTTPSQMKDAILTAFQEKVHSLQDEAKKRAQSVAEEIRQLK
MSIAAKAQGHHAHGSGGLGAEKQSHGNGCSGLLCGSQHAGGASKKRPRGVGTAEVLGLQS
VRDEKDCRPEDNLPAPLTSGFIPLIGVHLGKTVIDRCFNVGWFEGLITEYSAVAVEDGKW
YANQFQVEYEDGDTECLKVEELVHLLAEHGIRHTDPATRHQYKTTTLDKLLSPEILAAKK
ELNLRFRRCKMLEEKEEPEVARKRKKNGKKAKKTENSEDDADGEKENETEAEVADAGDEA
EDEGRTKKDTGGKENTRVPKKGKKPMNEEKGGQLTESEAGSEKKTESETHEEMNMSKEAN
SSDAEASEASSARHA
NT seq 4908 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcaagccgcagcgcgggctggcgcaatgccgcccgaagacggacaccctcgg
cctccgtcgaggagcgcgaaagttccatctggcgacacgaagcgagaaagcgacatcgag
gctggggctcagtctcctcttttggtcatccctccccctcggatagaccttttccctccc
gaaccggaagcgggcaaacaggtcgactggctgccgcctcaccggtatgctgagggcctg
actcctgaattgcgccgaaacctggaggaaagaggcttgcgcccttgcagtctgcgagag
gttctggagagaagaaacaagatgtgggcgaaagttcagatgatcagtccggaagcgcgg
ggcgaaaaggagcggctcgactctctcttcaagcagcagtgtgtgggctggggaaacaac
caggagggctgggtctatggcaagtggaatcccgtcattctttgcccggactttcggcag
ggaggcttgcaagtgtctcgatcggggcgtcggcaactgtgggagtgcttgaagtccgtc
gtcgagggctttgtcgacccgcggctgcagatatgtgaagtcgtggatccaacgcacccc
gttcgcttcgctacaccgccgcaggagacgtgctacactgtcgtctacgtcggaccaaag
attcctgcttcgcggaaggcgcgagtcgttttcggcgagtatacaggcgtcgttaaagat
ggaggccttgtcaagaaaagattcgaatacgtcttcgacctctcgttctccgcgttggca
tggcgccgcgccgaggagttcgaaacggcgtcagactcctcagatgacgactgccccagt
ctcccttctcgagatagcagggacgagaaattgtccgagtctcctgtctcctctgggtct
gtcacctcgcagtcgcgtcagctgtcgcgtctccctggagggaaggaccgaaagaaatcc
gtgactgtgtcgggacgccgcgacgcgaaaggcttaacaagagtcgagctgccagcccgc
agtcagttcgtcttggactcctctgaagcctgcaacgaaatgtctctcgtcaaccactac
ggcacaattgaactgctcggcgactgcgtatgcaagcgaaacagcgaatggcagcaagtc
tttgtcgacggctggcctcatatcgtcctgacttcgattcctggagtggcggttgagccg
ggtgatgaaattctcgcagatttcgggaacgcgtggttcttcaaagttcaggatgcgtct
cacgaagctatcgcgagggagcttctcgaataccgcgtcggaatccgaacggcgccttcc
cagaagctcgtgccagcgagaccggtggagtgcgtgaatcgacgatcggatccgcagctg
gagaatcgagcgcgacttggagagatttgcccgtattgcctgagtcatgaacatcgtccc
tgcgcctcgtctctggcgccgtctccgtcgacggagagtcgcgagccgagcaagatgtcc
aagagtccggaggaggcacatggccgcgggcgagagggcggcgccgagacggggaggtgc
tcgtcctcgtcagggtggagcgcggagaggaagagcagcggggaggctgcgacaccggcg
gagaaaccagtttctgggctttgcgagaagctgaggaacgacgggagaggcagagagaag
gccgatgaaccgcgaagcctgtcttccttgtcttccggtttccccatgtgctcggcaagc
actccgtcccagagacaaagtggatctcgttcttccccctcgagttcagaccttcttctc
gtcacgcagcagctcgaaagagagaagcacagctcggaccaagcgtccgtcgccgctgct
agccccgacttgagtctgcctcccgccccgccgccaccgacggcggtcatgacaccgcag
ccaaagggtaacgcggaagagaagttcgtggaaacgaacacggaggaaacaggccgtctc
gcaccttgctcattttcaggggacgaggtcgttcactgcgacggatgtgaccgcccgtgt
cacctgcggtgcctgccggacccagaagcgatcttgaatgactggcggtggtactgcgcg
gtgtgtcgcatgcgctttttcgagatgtctcgacacctcaactacaagattcttttgtct
tctgaagcgctcgcgtccctcgagaaagagggcattctcgcgtccgtcggaaacagagag
ggtcacgaggtcaagtggactgccgcgcaggccgggaacatgggtgtccacgcgctcgcg
aagactccggatggagaggcggccgccgacgaagtggaaaggaagaaggagaggcgcccg
agctgcgggggaatcgagcaccactcccgccgtcgcgagtctcctgagcctgtcgctgga
ggccgaagaagggcagagagagagacggaagatgagaaccccggaaaagcgaagaagtgg
agaggaagccgagtcagcaaagagaggagcgcgagcacagggtctcagaggagaactggg
cagcatggagacgaaacggaggggcaagagacggagaaagaagaccagaccaagtcggag
ggatcgccaactcttctgagtggtcggcagaggtcgcgagggctgcgagaacctcgacag
gaagaaaagacgcgtgcaggagcggaactcgtggggacgcaaaactcgggagtgaagaca
gaactgtcggagatggaagtattgagtggagactctcgtagcagcaacatcgaagccccg
gtgggtgtgaacacagacggaaaaggagaggcatgcagcggccggagacagctagcctcg
gtctcggacgcgcgcatgccgactggttcggtttctctcggtggagaggcgcaagagaaa
gagaacaaggagcctctgacggcagtcggcatggagttcctcaatgtcccgctcgaagaa
ctcggaaagggcagcggagccatgctgtggaacgaggcagacgaagcatccctgtccccg
gtggctgtgtctcagctgggttgtgggcctttgagagacggcgctggcacaaacgagggc
aatgacgttgttttgaggcctgggtcgacagaagcgacaggtaccgagggaacctgcagt
gcagaatcgctgccagaatgcagtcgtagcctcgtcggcaaggaacaggacgttttctct
ttttttctgggttctcgtgacacggcgaacacgagcgcgtcgcacactggtccgcctcga
tctgacgcgcgcggtaaggaagagaaagacgcaaaggatgtatcgcccactggaagagag
gcgcatgaagactgctctcagtccgacggtccgtctcgcgtgtcgggtgctggtcctctc
gctgttgtcacgacgactgctccgtcatcggagagcgacgaggacggaggaaaggaagtg
cgagtgggcattcgcgagtcttctccctccaggggcctagacaggtcgggcgcccaaccg
acatctgtggactctgtccggcctcgcgcgcgctgtcattcgtcggagaggagaagcgac
gcgaaccgcttcgaccttccaccggtggggattcgcgagagaagagccgttttcgcgtcc
tgcaacgaaaaggcgtctctggggcgaatgaccccgtcgcgagtcgagattgtaaagggg
gatctgtccagcgacgaactgcaaggactgcaaacgctgcacctcgtcgatcccaaaggc
ttgctcggcagtttgcaaccctgcgatgtctgctacaaggcgctgggcggacgcgcttct
accgaggtctgccggctcgcgaagcgccacctgtccccgaactgggatcacccacactcg
acgacgccgagtcaaatgaaggacgcgattttgacggccttccaggagaaggtccacagc
ctgcaggacgaggcgaagaagcgcgcgcagagtgtcgcggaagagattcggcagctcaag
atgtcgatcgcggccaaggctcagggacaccacgcccatggaagcggtggcctcggcgcg
gagaagcagagccatgggaacggctgcagcggcctcctctgcgggtcgcaacacgcggga
ggagcgtcgaagaagcggccacgaggtgtaggtacagctgaagtgctgggcttgcagagt
gtccgagacgagaaagactgcaggccagaagacaacctgccagctcctctcacttcggga
ttcattccactgatcggcgtgcacctcgggaagacggtgattgaccgatgcttcaacgtc
ggctggttcgaaggtctcatcaccgagtactccgcagtcgccgtcgaggacggcaagtgg
tatgcgaatcagttccaagtcgagtatgaggacggagacacagagtgtctgaaggtggag
gaactggtgcacctgctggctgagcatggcattcgccacacggaccctgcaactcgccac
cagtacaaaactacgacgctggacaagcttctctcgccggagatcctggcggcgaagaag
gagctgaatctacgtttccgaaggtgcaagatgttggaggagaaggaggaacctgaggtg
gcaaggaagcgcaagaaaaacgggaagaaggcgaagaagaccgagaacagcgaagacgac
gcggacggagaaaaggaaaacgaaacagaagcggaagtggctgacgcgggcgatgaagcg
gaggacgaaggccgaaccaagaaggatactgggggaaaggaaaatacgcgagttccgaag
aaaggaaagaaacccatgaacgaagagaaaggcggtcaacttacagaaagcgaggcgggc
tctgagaagaaaacggagagcgagacgcacgaggaaatgaatatgtcaaaggaggcgaat
agcagtgacgccgaagccagtgaagcgagcagcgcccggcatgcatag

DBGET integrated database retrieval system