KEGG   Toxoplasma gondii: TGME49_201270Help
Entry
TGME49_201270     CDS       T01093                                 

Definition
(RefSeq) hypothetical protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4129
Motif
Other DBs
NCBI-GeneID: 7894034
NCBI-ProteinID: XP_018637441
UniProt: S8GP32
Position
VIIa:complement(join(3918622..3918747,3919384..3919586,3919893..3920313,3921004..3921183,3921716..3921809,3922146..3922416,3922799..3924398))
Genome map
AA seq 964 aa AA seqDB search
MGSPNSSLPAHDREFGNTEDSLMARTDYGKEHSETALGGPQRMDDRAKSSVFSVRCPGAL
ARGGEKAYTGLIGEVTDPRLETSELGSRFMVDTVFPLCSSRIKHWCLRRDTLVSDCENSR
TPCVRYGAFAGASPLFDRAESVSAPGETRMVSDRLSLWGEFPLSGIASETAYSGLGSNMV
TPRRHTIGCVALFRAAKKTSESVSAVKPEPRPSTTRSTNATSRHTSLCGPSVGKSACHSW
TPGIRPLRVVSEKCEQRCKGEETGCGQQESRGRTTVSEEVVLRRSGAVSRQGVDDAQKKQ
RKTVLRLFCWVRPFLRLASFIFVVSLLAFWSKDGAYALTCDSRGSGLPHVFFSTSSVSLY
PCLPHEKRCCQRALPESFSPDFDPSSLRTDLPSLTHPLPFSVSPRYLSGRQAPDHSSSLL
SRRLFGAALSATASPTAVPSFSCFLTPLNTERSPCFTLAPKVSPLRETPTHRFTVDVAAS
SLSAERGGAQGIQGGFWNGMSSSGKSSTASSSGLQGSSLRRHSNDSDEAPSRTQEEWVEE
LTAALQSGALKIPALTVEVTKAAGGRQITPRGLDDLIKAAAAVRAGLPLPSHLFQPEEEE
SGKEDVVDQSLQKTKGSSKAEENKSSNEGKRSVAAYADEARRLQANLDGVNEEKKEFFLN
AYRRELRHRGVDDHDCQTPQDLCNRLAFARVFNSSKGSRGASKAAREAGTVKVVRAEVTD
GGRGRRSRRSRGRLVARLSSADDDDADGDADDGSSSGIVQISPGVFMARGGSLGGGTGSP
FDRLFADVFGGSFFGGRPEGEDDESSEEDGEDGVSPRRGVRGGSLLDHLFGGDLFSSLLG
GGLMSGGLREAEDDEGSAKARVKKLDFKTAESAEASRQPGSVDKTQDDDVSAEETDTRLL
QLLNKAQARSDPSLAMFLKKSFRDPSLREMLLTAQTEGVEAAEAMADGRGKYVLQRLKDN
QLFG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcctaactcatctctgcccgcacatgaccgggaattcggcaacaccgaagat
tctctgatggcacgtaccgactatggaaaggagcattcagaaacagctctaggggggcct
cagagaatggacgacagagccaaatcgagcgtgttttctgtgcgctgccctggtgcccta
gcccgaggaggcgaaaaggcctacacagggctgataggggaagtcactgacccaagactg
gagaccagtgaattgggctctcgcttcatggtggataccgtgttccctttgtgttcgtct
cgaataaagcattggtgtcttcggcgggacacgctcgtctccgactgtgaaaattcgcga
acgccgtgcgttcgttacggtgcttttgcgggtgcgtccccactatttgatcgggcagaa
agcgtttccgcgcccggcgaaactcgcatggtttctgatagactttcgctttggggtgaa
tttccactttcaggaattgcctcagagacagcatacagtgggcttggaagcaatatggtc
actcctaggcgacacacgataggttgtgttgcgctgtttcgggctgccaaaaagacgtct
gaatcggtttcagcagtgaaaccggagccccgtcctagcaccacacgatccacaaatgcc
acttcgaggcatacatcgttatgtgggccttccgttggaaaaagtgcctgtcattcctgg
actcctggtattaggccgctacgggtggtttcagagaaatgcgagcaacgttgcaagggc
gaggagacgggttgtggccaacaagagtcgcgcggccgaacgactgtctccgaggaagtg
gtgttgcgtagaagtggtgctgtgagtagacagggtgttgatgatgctcagaagaaacaa
aggaagacagttttgcgtctcttctgttgggtccgtccatttcttcgtcttgcgtcgttc
atctttgtcgtttcactcttggctttctggtccaaagatggtgcatacgccctaacatgt
gactctcgtgggagcggtttgccgcacgttttcttttctacatcaagcgtttcgttgtat
ccatgtttgccgcacgaaaaacgctgttgccaacgtgcacttcccgagagtttctcacct
gatttcgatccgtcttctttacggacggatctaccgtcgctgactcatccattgccgttc
agcgtcagtcctagatatctctccggcaggcaagcgccagatcactcgtcgtctctcctc
tctcggagacttttcggagctgcgctgtcagcgactgcttccccaacagctgtcccctcg
ttctcgtgtttcctcactcccctcaacactgaaagatctccctgttttaccctggcaccg
aaagtgtctcctctcagagaaacgccgacacaccgcttcaccgttgacgtcgctgcttcc
tctctgtcggctgagagaggaggtgctcaaggaatacaggggggattttggaatgggatg
tcaagcagtggtaaatcgtcgaccgcgtcgtcttcaggcctacaggggtcgtcgctgagg
cgccactccaacgacagcgacgaggcaccgtctcgcacacaagaggaatgggtggaagag
ctaaccgcggcacttcagtctggcgctttgaagatccccgccctaactgtagaagtaaca
aaggcagcaggtgggagacaaataacgcctcgaggacttgacgatctcattaaagcagct
gctgcggtccgtgccggccttcctctgccgtcccacttgtttcagcctgaagaggaagaa
agtggcaaagaggatgtggtggaccagagcttgcagaagacgaaaggcagtagcaaggct
gaagagaacaaatcctcaaacgaaggaaagcgaagtgttgcggcgtacgcagatgaggcg
cggcggctgcaagcgaatctcgatggcgtgaacgaagagaaaaaggagttctttctaaac
gcatatcggagagaactgcgtcataggggagtggacgatcacgactgccagacaccccaa
gacctgtgcaatcgcctcgcgttcgcgcgtgtcttcaacagttctaagggctccagaggc
gcctcaaaggccgcaagggaggcaggaacggtgaaagttgtgagggcggaggtaacagac
gggggacgaggtagacgatcacgccgctcacggggtcgcctcgtagctcgcctttccagc
gctgacgacgacgatgcagacggtgacgcagacgacggtagttcttccggaattgttcag
atttctccaggcgtgtttatggcgcgaggtggttcgttaggtgggggaacgggcagtccg
tttgaccgtttgttcgccgacgtctttggaggttctttcttcggaggacggccagaggga
gaggatgatgagtccagtgaagaggacggagaagatggggtttcaccgagacgaggggtg
cgaggtggcagtctcttggatcacctcttcggtggagacttattctctagcttactggga
ggtggcctgatgagtggaggccttcgtgaagctgaagatgatgaaggcagtgcgaaagcg
agagtgaagaaattggatttcaagactgcagaaagtgcggaagcaagccgccaaccgggt
tccgttgataaaacacaggacgacgatgtgtctgctgaagagacagacaccaggctgcta
cagctgctgaataaggcgcaagctaggagtgacccctcgcttgccatgttccttaagaag
tccttccgggatccgtcactccgagagatgctgctgaccgcccaaacggaaggtgtggag
gcggcagaggccatggcagatggtcgaggaaaatatgttcttcagagactgaaagataat
cagttgtttggttga

DBGET integrated database retrieval system