KEGG   Toxoplasma gondii: TGME49_201380Help
Entry
TGME49_201380     CDS       T01093                                 

Definition
(RefSeq) chorismate synthase, putative
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
tgo  Toxoplasma gondii
Pathway
tgo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tgo01100  Metabolic pathways
tgo01110  Biosynthesis of secondary metabolites
tgo01130  Biosynthesis of antibiotics
tgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TGME49_201380
Enzymes [BR:tgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     TGME49_201380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-GeneID: 7894170
NCBI-ProteinID: XP_002367454
UniProt: S8F9P4
Position
VIIa:join(3911782..3912007,3912606..3912850,3913053..3913346,3913705..3913774,3914442..3914518,3914795..3915233,3915795..3915899,3916089..3916150,3916677..3916769)
Genome map
AA seq 536 aa AA seqDB search
MSSYGAALRIHTFGESHGSAVGCIIDGLPPRLPLSVEDVQPQLNRRRPGQGPLSTQRREK
DRVNILSGVEDGYTLGTPLAMLVWNEDRRPQDYHALATVPRPGHGDFTYHAKYHIHAKSG
GGRSSARETLARVAAGAVVEKWLGMHYGTSFTAWVCQVGDVSVPRSLRRKWERQPPTRQD
VDRLGVVRVSPDGTTFLDANNRLYDERGEELVEEEDKARRRLLFGVDNPTPGETVIETRC
PCPSTAVRMAVKINQTRSLGDSIGGCISGAIVRPPLGLGEPCFDKVEAELAKAMMSLPAT
KGFEIGQGFASVTLRGSEHNDRFIPFERASCSFSESAASTSKHERDGCSAATLSRERASD
GRTTSRHEEEVERGRERIQRDTLHVTGVDQQNGNSEDSVRYTSKSEASITRLSGNAASGG
APVCRIPLGEGVRIRCGSNNAGGTLAGITSGENIFFRVAFKPVSSIGLEQETADFAGEMN
QLAVKGRHDPCVLPRAPPLVESMAALVIGDLCLRQRAREGPHPLLVLPQHSGCPSC
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctatggagccgctctgcgcatacacactttcggtgaatctcacggctcagcc
gttgggtgtataatcgacgggctgcctcctcgcctccctctttctgtcgaagatgttcag
cctcaattaaatcgcagaagacccggccaagggcctctctcgacgcagcggagagagaaa
gatcgagtcaacatactctccggtgttgaagacggatatacactcggtactcccctggcg
atgctcgtctggaatgaagaccggcggccccaggactaccacgccctcgcgacagtcccg
cgtccaggtcacggggatttcacctaccatgcaaagtaccacattcacgcgaaaagcggg
ggcggtcggagcagcgcgcgggagactttggcgcgcgtcgccgctggagcagtcgttgag
aagtggctaggcatgcactacggcaccagcttcacagcttgggtgtgtcaggttggtgat
gtctctgtgccccgatcgctccgaagaaagtgggagcggcagccgccaactcgccaagac
gtcgatcgccttggcgtggtccgcgtgagcccagatggaaccacatttctcgacgcgaac
aaccgcctttacgacgagcgaggagaggaactcgtcgaggaggaagacaaagccaggcgt
cggcttcttttcggagtcgacaacccgacgccaggagaaacagtgattgagaccaggtgc
ccgtgcccctccacagctgttcgcatggctgtgaaaatcaaccagacccgatctctgggc
gattcgattggcggatgcatctccggtgcaatcgtgcggccaccgctgggcctcggcgag
ccgtgtttcgacaaagtggaggcggagctggcgaaggcgatgatgtcgctccctgctacg
aaagggtttgagattggccagggctttgcgagtgtcacgttgcgaggcagcgagcacaac
gaccgcttcattcccttcgagagagcgtcgtgttcattctcggaatcagccgcgagcacg
agcaagcatgaaagagatgggtgttcagctgctacactctcacgggagcgagcgagtgac
ggtagaacaacttctcgacatgaagaggaggtggaaagggggcgggagcgcatacagcgc
gataccctccatgttactggtgtagatcagcaaaacggcaactccgaagattcagttcga
tacacttccaaatcagaggcgtccatcacaaggctgtcgggaaatgctgcctctggaggt
gctccagtctgccgcattccactaggcgagggagtacggatcaggtgtggaagcaacaac
gctggtggaacgctcgcaggcattacatcaggagagaacattttttttcgggtggccttc
aagcctgtttcttccatcggcttggaacaagaaactgcagacttcgctggtgaaatgaac
cagctagctgtgaaaggccgccacgatccctgcgtccttccgcgagcccctcctctggtt
gagagcatggctgcccttgtgattggcgatctgtgcctccgccagcgcgcccgggaaggg
ccgcacccccttctcgtccttcctcaacacagtggttgcccatcttgctga

DBGET integrated database retrieval system