KEGG   Toxoplasma gondii: TGME49_201390Help
Entry
TGME49_201390     CDS       T01093                                 

Definition
(RefSeq) hypothetical protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDUF_B12 SARAF 2Fe-2S_Ferredox
Motif
Other DBs
NCBI-GeneID: 7894182
NCBI-ProteinID: XP_018637440
UniProt: S8F6J3
Position
VIIa:complement(3910426..3910752)
Genome map
AA seq 108 aa AA seqDB search
MKTLHLLLFAVVAIALCGLATASHGTTFQDAGARADAFAARVAGARAAVVSGLTSENGLW
RRTQARLGFWPGYLVGAAAVAVALVTGYALGKRRERSKWKKALKNRLD
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaagactcttcatttacttcttttcgcggtggtggccatcgcgctttgtggcctggcc
acagcgagccacggcacaacgtttcaagacgcaggtgcaagagcggatgcctttgcagcc
agggtggcgggtgcgagggcggcggtagtttccggcttgacaagcgagaacggcctttgg
cgtcgcactcaagcaaggttaggcttctggcccggttacctcgtgggtgccgctgcagtt
gccgtggccttggtgacagggtatgcactggggaagaggagagagaggtctaaatggaag
aaggccctgaagaatcggctggactaa

DBGET integrated database retrieval system