KEGG   Toxoplasma gondii: TGME49_201640Help
Entry
TGME49_201640     CDS       T01093                                 

Definition
(RefSeq) hypothetical protein
Organism
tgo  Toxoplasma gondii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flexi_CP_N CDT1_C
Motif
Other DBs
NCBI-GeneID: 7894308
NCBI-ProteinID: XP_018637436
UniProt: S8F9J3
Position
VIIa:complement(3879984..3883751)
Genome map
AA seq 1255 aa AA seqDB search
MENYHRVKRPMSPPPSLIAAAAFFIFCSFATGVEPKDGAASTAFVNRQSSPAALPDTGEA
IEWRSHTASSRQSEDNAAGMQSVVRSTGLSQSGQHAVQDALDRRDYTDDRREKDESGEGE
NDQSRDTQTAPGAPNEGGKSRKALEGASSGARQREQVAKHDVDAKRPLTANNMVRPGAGV
PRFALKVPEGRGQKMKAKPDSQSPATGTIQASDSAATLPVDSTAEHSRHALQQEQITEWE
LAEPRRKSNAATRNLTTAQYDTAVVPPEATPDASGEEQMVRPVVVAAQAELRGRTDGKTT
PCNVSVAGVSTGQQAAVEGCLDGSETRGEGDTGETGTTVSWLHKKMLGEEDSDGTAPERT
LPSHVLSLRTEGEYENTTKEYFELGKIFREDSSLMPRTYTRQTNLEEKHYLRPRDRVTEE
GKKTQPLSEEPLLHRELLEEGNQNDKLLKNYGESADTAATPEEHQMNPVAPTYDKRKNDV
FQRQHMSTPSEQLKLTKEGSSAGSHVPESSSEPGGQRVPASTREAYGSEHDSGTLASSHV
QKDVASTSDNGLPRIDEMDQKLQLGKQDVSGTEEAEGHHQRQPEESVNGDSEPIGGGTPD
ERESIHLSQDGVEKGPLQALQQDGGAGGKETSSPEAAEGSALKEPQAGPSSSSGDTVLFQ
QVSGFPLSLEFSISSVASSDPTVDNNAERHRSRPNVSSSKDDTEQQSSDQRRPGRGYPSE
GQLVHGSVVETLHEDDGVSTLPSRTDEQAKSDTEDVDSLPQMKLEPLFVDVDSDGTNYEK
EDSHEDGETGDSMGVRALDPEKSGTQGETEFIPVEHRTLEEASRDEVQTEEGAQGRKESA
QKAENDPGERVAKGIAQKPPAGQSRTRVRGDGAETGHTSPLNGDRKIHVGTKAASEAELE
GKLQELTEQEGSSERMKERGAHDQNEEQTRNHRNEKSTAELDEEGNSEADRLNDYLKDPG
LEDGRLDALLVETETNRTDSNADHKKEGSRVAKMFEEIHSEQDVQQQTRDTGRTEVDCDV
VEERHQVNGKRGTQRGEDKTEQLEPEMSRNKTELTTGELMVGTNPGKALQVKRRNAGEAQ
RSSEDDLSDVVQELVAVSAARDGKRSSEWLPVAAEVRDSTRTSVNKKEIASLAFSSPGLR
DRFTVAPESASSKQDKKLAQTAAAQVTAVHLENVHFESGRRKTFLSTQPLSHMLPDLVDF
ESLPVSTLSLPTPLASETAKEVSDEAGDTVVDPPSPLVLHFMHLPKSQMMLNDVH
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atggagaactaccaccgtgtgaaaaggcccatgagtccaccaccatcattgattgccgcc
gcagcctttttcatattttgctctttcgcgacaggtgttgaaccgaaagatggagcagcg
tccacggcttttgttaataggcagtcctctcctgctgccctcccagacacaggggaggca
atcgaatggcgctcccacactgctagttccagacagtcagaggacaatgccgcgggaatg
cagtcggtggtacggagcactggcctgtcacagtcaggccagcatgcggtccaagacgcc
ctggaccggcgtgactatacagacgatcgaagagaaaaggacgagagtggagaaggagaa
aatgaccaatcgcgggacactcaaactgcgcctggtgctccgaacgaggggggcaaaagc
cgaaaagcacttgaaggtgcctccagcggcgcacgccagcgagagcaagtggcaaaacac
gacgttgatgctaaaaggcctcttacggcgaacaatatggtacggcctggtgctggagta
cccagatttgctttgaaggttccagagggtagagggcaaaagatgaaggccaaaccggac
tcgcaatcacctgcaactggaacgattcaggcatcagactcagctgcgacattgcccgtc
gacagcactgccgaacattctcgacacgcacttcagcaagagcagatcactgaatgggaa
cttgcggaaccgcgacgaaaatcgaacgccgcaacaagaaacttgacgacagcgcagtac
gacacggcagtcgttcccccggaagcgactccagacgcatcgggagaagaacaaatggtc
cgccccgtcgtggttgcagcgcaagcagagttgagaggccgcacagacggaaaaacgacc
ccatgtaacgtgtccgtcgctggtgtttccacgggacagcaagctgcagttgaaggatgt
ctagacggaagcgagacccgcggtgaaggcgatactggagaaacaggcactacagtctct
tggctacacaagaaaatgttaggcgaggaagactctgatggtacagcgcctgagaggact
ctgccttcacacgtactctccttgcgtacagagggcgaatacgaaaacacaacaaaggaa
tacttcgaactagggaaaatttttcgagaggacagttcattgatgccgcggacctacact
cggcaaaccaatctggaggagaaacattatttgcgaccgagagacagagtcactgaagag
gggaagaaaacacaacctctatctgaggagccattattacaccgagagctcttggaggaa
ggaaatcaaaacgacaagctcctgaaaaactatggcgaatctgcggacacggctgcgacg
ccagaggagcaccaaatgaacccagtggcacccacgtacgataagagaaagaacgacgtg
tttcagcgacagcacatgtctacgcctagcgagcagttgaagcttacgaaggaaggcagt
tctgctggttctcacgtccccgagtcttcgtcagaaccagggggtcaacgtgtgccggca
tcgaccagggaagcctacgggagcgagcacgatagcggaaccctggcatcaagccacgtg
cagaaagatgtggcatcgacgagcgacaacgggctaccaaggattgatgaaatggaccaa
aaactgcaacttgggaagcaagacgtctccggcacagaagaagcagaaggacaccatcag
cgtcaacctgaggagagtgttaatggagactcggagcctatcggtgggggaacccccgac
gaaagggagagtattcatctctcgcaggatggagtggaaaaaggccctttacaggcgttg
cagcaagatggaggtgccggtgggaaagagacctcctcgccagaagcggcagaaggatct
gctctgaaagaacctcaagccggcccatcgtccagttcaggtgacacagtgctttttcaa
caagttagcggcttcccgctctcattagaattcagcatttccagcgtcgcctcatccgat
cccactgtggacaataatgcggaaagacaccgaagccgaccgaatgttagcagctccaaa
gatgatacagagcaacaaagcagtgatcagcgaagaccaggacgtgggtacccgtcagaa
ggtcagttggttcacggcagtgtggttgaaacgcttcatgaagacgatggagtgtctacg
ttgccaagtagaacagacgagcaggcgaagtcagatacagaagatgtcgattcgctgccg
cagatgaaattggaacctttgttcgtagatgtcgattccgatggaactaattatgagaaa
gaggatagccatgaggatggtgagacaggtgacagtatgggcgtaagagcattggatcca
gagaaaagtggcacacagggagaaaccgagttcataccggtagaacatcgaactctggag
gaagcgtcgcgggacgaagtgcaaacggaagaaggcgcacagggacgaaaagaatcggca
cagaaagctgaaaacgacccgggtgagcgagtagcgaagggaatcgcccaaaagcccccc
gcaggccagtcacggactagagtacgaggcgatggcgcagaaacggggcacacgtcgcct
ctcaatggagacaggaaaattcacgtgggaacgaaagcagcatcggaagctgaactcgaa
ggcaaattgcaggaactaacagagcaagaaggatcttccgagcggatgaaagaacgaggg
gcacacgaccagaatgaagaacaaacgagaaaccacagaaacgagaaaagcaccgctgaa
ctcgatgaagaaggcaatagcgaggcagatagactcaacgactacctgaaagatcctggg
cttgaagatggaaggctggatgctcttcttgtcgaaactgagaccaacaggacagatagt
aatgcagaccataagaaagaaggtagcagagtagcgaaaatgtttgaagagattcattcg
gaacaggatgttcagcagcaaacacgagatactggtagaacagaagtcgactgcgacgtt
gtagaagaaaggcaccaagtgaacgggaaacgtggaacccaaagaggagaagacaaaact
gaacagctggaaccggagatgtcaaggaacaaaactgagttgacaaccggtgaattgatg
gttggaacaaatcctggaaaagcactacaggtgaagcgccgaaacgcgggtgaagcgcag
aggtcctctgaagacgatttgtcggacgtggttcaggaacttgtggctgtttctgctgca
cgggatggtaaaaggagttctgaatggctgccggtggcagcagaggtgcgcgactcgact
agaacttcggtgaataagaaggaaatcgcctctttggcattttcttcaccggggctgcgg
gaccgcttcactgtggcgcctgaaagtgcatcatcaaaacaggacaaaaaactagcccag
accgcagcggctcaggtaactgcagtacacttagaaaatgtacatttcgaaagcggtcgg
cgaaaaacttttctgtcaacacagccgctatcgcacatgttgcctgaccttgttgacttt
gaaagtcttcccgtgtccaccctcagcttgcctacgcccttagcttctgagacagcgaaa
gaggtctctgacgaagccggagatacggtggttgacccaccatcccctctcgtacttcat
ttcatgcatttgccgaaatcgcagatgatgctgaatgacgtgcactag

DBGET integrated database retrieval system